KEGG   Saccharomyces cerevisiae (budding yeast): YKL035WHelp
Entry
YKL035W           CDS       T00005                                 

Gene name
UGP1
Definition
(RefSeq) UTP glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00040  Pentose and glucuronate interconversions
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
Module
sce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YKL035W (UGP1)
   00052 Galactose metabolism
    YKL035W (UGP1)
   00500 Starch and sucrose metabolism
    YKL035W (UGP1)
   00520 Amino sugar and nucleotide sugar metabolism
    YKL035W (UGP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YKL035W (UGP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP DUF4301
Motif
Other DBs
NCBI-GeneID: 853830
NCBI-ProteinID: NP_012889
SGD: S000001518
UniProt: P32861
Structure
PDB: 

Jmol
Position
XI:369891..371390
Genome map
AA seq 499 aa AA seqDB search
MSTKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFR
RYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR
IRSFNQSRFPRVYKDSLLPVPTEYDSPLDAWYPPGHGDLFESLHVSGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP
KEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQL
ETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPNPL
IKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIP
NGSILENVVVTGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaagaagcacaccaaaacacattccacttatgcattcgagagcaacacaaac
agcgttgctgcctcacaaatgagaaacgccttaaacaagttggcggactctagtaaactt
gacgatgctgctcgcgctaagtttgagaacgaactggattcgtttttcacgcttttcagg
agatatttggtagagaagtcttctagaaccaccttggaatgggacaagatcaagtctccc
aacccggatgaagtggttaagtatgaaattatttctcagcagcccgagaatgtctcaaac
ctttccaaattggctgttttgaagttgaacggtgggctgggtacctccatgggctgcgtt
ggccctaaatctgttattgaagtgagagagggaaacacctttttggatttgtctgttcgt
caaattgaatacttgaacagacagtacgatagcgacgtgccattgttattgatgaattct
ttcaacactgacaaggatacggaacacttgattaagaagtattccgctaacagaatcaga
atcagatctttcaatcaatccaggttcccaagagtctacaaggattctttattgcctgtc
cccaccgaatacgattctccactggatgcttggtatccaccaggtcacggtgatttgttt
gaatctttacacgtatctggtgaactggatgccttaattgcccaaggaagagaaatatta
tttgtttctaacggtgacaacttgggtgctaccgtcgacttaaaaattttaaaccacatg
atcgagactggtgccgaatatataatggaattgactgataagaccagagccgatgttaaa
ggtggtactttgatttcttacgatggtcaagtccgtttattggaagtcgcccaagttcca
aaagaacacattgacgaattcaaaaatatcagaaagtttaccaacttcaacacgaataac
ttatggatcaatctgaaagcagtaaagaggttgatcgaatcgagcaatttggagatggaa
atcattccaaaccaaaaaactataacaagagacggtcatgaaattaatgtcttacaatta
gaaaccgcttgtggtgctgctatcaggcattttgatggtgctcacggtgttgtcgttcca
agatcaagattcttgcctgtcaagacctgttccgatttgttgctggttaaatcagatcta
ttccgtctggaacacggttctttgaagttagacccatcccgttttggtccaaacccatta
atcaagttgggctcgcatttcaaaaaggtttctggttttaacgcaagaatccctcacatc
ccaaaaatcgtcgagctagatcatttgaccatcactggtaacgtctttttaggtaaagat
gtcactttgaggggtactgtcatcatcgtttgctccgacggtcataaaatcgatattcca
aacggctccatattggaaaatgttgtcgttactggtaatttgcaaatcttggaacattga

DBGET integrated database retrieval system