KEGG   Saccharomyces cerevisiae (budding yeast): YKL035WHelp
Entry
YKL035W           CDS       T00005                                 

Gene name
UGP1
Definition
UTP glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YKL035W (UGP1)
   00052 Galactose metabolism
    YKL035W (UGP1)
   00500 Starch and sucrose metabolism
    YKL035W (UGP1)
   00520 Amino sugar and nucleotide sugar metabolism
    YKL035W (UGP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YKL035W (UGP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XI:369891..371390
Genome map
AA seq 499 aa AA seqDB search
MSTKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFR
RYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR
IRSFNQSRFPRVYKDSLLPVPTEYDSPLDAWYPPGHGDLFESLHVSGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP
KEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQL
ETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPNPL
IKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIP
NGSILENVVVTGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaagaagcacaccaaaacacattccacttatgcattcgagagcaacacaaac
agcgttgctgcctcacaaatgagaaacgccttaaacaagttggcggactctagtaaactt
gacgatgctgctcgcgctaagtttgagaacgaactggattcgtttttcacgcttttcagg
agatatttggtagagaagtcttctagaaccaccttggaatgggacaagatcaagtctccc
aacccggatgaagtggttaagtatgaaattatttctcagcagcccgagaatgtctcaaac
ctttccaaattggctgttttgaagttgaacggtgggctgggtacctccatgggctgcgtt
ggccctaaatctgttattgaagtgagagagggaaacacctttttggatttgtctgttcgt
caaattgaatacttgaacagacagtacgatagcgacgtgccattgttattgatgaattct
ttcaacactgacaaggatacggaacacttgattaagaagtattccgctaacagaatcaga
atcagatctttcaatcaatccaggttcccaagagtctacaaggattctttattgcctgtc
cccaccgaatacgattctccactggatgcttggtatccaccaggtcacggtgatttgttt
gaatctttacacgtatctggtgaactggatgccttaattgcccaaggaagagaaatatta
tttgtttctaacggtgacaacttgggtgctaccgtcgacttaaaaattttaaaccacatg
atcgagactggtgccgaatatataatggaattgactgataagaccagagccgatgttaaa
ggtggtactttgatttcttacgatggtcaagtccgtttattggaagtcgcccaagttcca
aaagaacacattgacgaattcaaaaatatcagaaagtttaccaacttcaacacgaataac
ttatggatcaatctgaaagcagtaaagaggttgatcgaatcgagcaatttggagatggaa
atcattccaaaccaaaaaactataacaagagacggtcatgaaattaatgtcttacaatta
gaaaccgcttgtggtgctgctatcaggcattttgatggtgctcacggtgttgtcgttcca
agatcaagattcttgcctgtcaagacctgttccgatttgttgctggttaaatcagatcta
ttccgtctggaacacggttctttgaagttagacccatcccgttttggtccaaacccatta
atcaagttgggctcgcatttcaaaaaggtttctggttttaacgcaagaatccctcacatc
ccaaaaatcgtcgagctagatcatttgaccatcactggtaacgtctttttaggtaaagat
gtcactttgaggggtactgtcatcatcgtttgctccgacggtcataaaatcgatattcca
aacggctccatattggaaaatgttgtcgttactggtaatttgcaaatcttggaacattga

DBGET integrated database retrieval system