KEGG   Saccharomyces cerevisiae (budding yeast): YKL057CHelp
Entry
YKL057C           CDS       T00005                                 

Gene name
NUP120, RAT2
Definition
Nup120p
Orthology
K14303  
nuclear pore complex protein Nup160
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YKL057C (NUP120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XI:complement(330856..333969)
Genome map
AA seq 1037 aa AA seqDB search
MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEYSNCL
LLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVN
VILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLED
GGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQN
CHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQM
GTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWKSGTA
SKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYGTQIF
ERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCFQPYN
HSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGEL
PDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKD
FISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLDLHYK
QFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITENSFF
MTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLH
DYPEAINDKLPTFLEDLKSENYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEF
ALKCISKSAEYSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTV
RTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWEC
FKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCYLMVINVLSSFDSAYDQWILN
GSKVVTLTDLRDELRGL
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctctcaagaattgatgcaaatttgctccaatattatgaaaaacctgaaccc
aataatacggttgatttatacgtcagtaataacagtaataataacgggctgaaagaagga
gataagtccatctctacaccagttcctcagccttacggaagtgaatattccaattgtttg
ttattgagtaactctgagtatatctgttaccatttttcctcaagatcaacattgttgaca
ttttatcctttgagtgacgcataccatgggaagacaattaatatacacttaccaaatgct
tctatgaatcagagatacactttaacgatacaagaagtggaacagcaattactggttaat
gttatcttaaaagatggttcgtttttaacgttacaactacccctaagtttcctattttca
tcggccaacactctcaatggagagtggtttcatctccaaaatccctacgactttacagtt
agagttcctcatttccttttctatgtatcaccccagttctcagttgtttttttggaagat
ggcggtttgttgggtttaaaaaaagttgacggcgtacattacgagcctttactattcaat
gataattcatacttgaaaagcctaacgcgatttttttctaggagttctaaatcggattac
gatagtgtgattagttgtaaattattccatgaaagatacttaattgtgttgactcagaat
tgccacttgaaaatttgggatttaacttcatttactttaatacaagattatgatatggtt
tcacagtcagattcagacccaagccattttagaaaagtggaagctgtaggggaatacctt
tccttgtataacaatactctagttacattgttgcctttggaaaatgggctttttcaaatg
ggcaccttgttggttgattcaagcggtattttgacttatacttttcaaaataacatcccc
actaatctttcagcttctgctatttggtcaattgtagatttagttctaacgagaccattg
gagttgaatgtcgaggctagttatttaaatttgatcgttttatggaaaagtggcactgct
agcaagttacagatactaaacgtaaatgatgaaagtttcaaaaactatgaatggatagaa
tcagttaacaaatccttagtagatttgcaatccgaacatgatttggatatcgttacaaag
actggagatgttgagaggggtttctgtaatttgaaatcaagatatggtacccaaattttt
gaacgtgcacagcaaatattgagtgaaaataagattattatggctcataacgaagatgaa
gaatatttggctaatttagaaacaatattgagagacgtaaaaaccgcattcaacgaggct
tcttctataacactttatggcgatgaaattattctcgtcaattgtttccaaccgtataat
cattccctttacaagctgaatactactgtggagaattggttttataatatgcactctgaa
actgatggttctgaattgttcaagtatttaaggacattgaatggttttgcttctactttg
tcaaatgatgttcttagatccatttctaagaagtttcttgatataataacaggagagctg
cctgattctatgactaccgtagaaaaatttacggacattttcaaaaattgcctagaaaat
caatttgaaatcacaaatctaaagattcttttcgacgaattaaactcttttgatataccc
gttgttttaaatgatttaatcaataaccaaatgaagcctggtatattttggaaaaaggat
ttcatctctgcaatcaaattcgatggtttcacaagtataatttccctagaatctcttcac
cagttactttccatacattatcgtattactttacaagtattgttaacattcgttctgttc
gatcttgataccgaaattttcggacagcatatatctacattattggatttgcattataag
caatttttattgttaaacctttatagacaagataagtgtctgttggcggaagttcttctc
aaggattcttctgaattctctttcggtgtcaaattttttaactacggccaactcattgcc
tatatcgattccttaaactctaatgtttacaatgcttccatcactgaaaattctttcttt
atgacgtttttccgctcatatatcattgaaaacacatctcataagaatataaggttcttt
ctcgagaacgttgaatgccccttctacttacgccacaacgaggtgcaagaatttatgttt
gccatgacgttatttagttgtggtaatttcgatcaatcctatgaaatttttcaactacac
gattatccggaggctatcaatgataaattgccgacattcttagaagaccttaagagtgaa
aactatcacggtgatagtatatggaaagatcttttgtgcacctttacagttccatatagg
cattctgcattctattatcaattatctctcttatttgatagaaataacagccaagaattt
gctttgaaatgtatatctaagtcagcagaatattcattaaaagaaattcagattgaagaa
ctgcaagacttcaaagaaaaacagcatattcattatttaaatcttttaatccacttcaga
atgtttgaagaagtcttggatgttttgagattgggtcacgagtgtctttccgacacagta
agaacaaattttctccaattattattacaggaagacatatattcacgagattttttcagc
acacttctgcgcttgtgtaacgcacattcagacaatggcgagctatatcttcgtacagta
gatattaaaatagtggatagtattctgtcacaaaatctacggagtggtgattgggagtgt
tttaagaaactttattgttttagaatgttgaacaaaagcgagagggctgctgcagaagta
ctgtaccagtacatattaatgcaagctgatcttgatgttattcgaaagagaaaatgttac
ctaatggtcatcaacgttttatctagctttgatagtgcatacgatcaatggattctaaac
ggaagtaaagtggttactttaactgatttaagagatgagttacgaggtctatag

DBGET integrated database retrieval system