KEGG   Saccharomyces cerevisiae (budding yeast): YKL057CHelp
Entry
YKL057C           CDS       T00005                                 

Gene name
NUP120, RAT2
Definition
Nup120p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XI:complement(330856..333969)
Genome map
AA seq 1037 aa AA seqDB search
MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEYSNCL
LLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVN
VILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLED
GGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQN
CHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQM
GTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWKSGTA
SKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYGTQIF
ERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCFQPYN
HSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGEL
PDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKD
FISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLDLHYK
QFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITENSFF
MTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLH
DYPEAINDKLPTFLEDLKSENYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEF
ALKCISKSAEYSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTV
RTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWEC
FKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCYLMVINVLSSFDSAYDQWILN
GSKVVTLTDLRDELRGL
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctctcaagaattgatgcaaatttgctccaatattatgaaaaacctgaaccc
aataatacggttgatttatacgtcagtaataacagtaataataacgggctgaaagaagga
gataagtccatctctacaccagttcctcagccttacggaagtgaatattccaattgtttg
ttattgagtaactctgagtatatctgttaccatttttcctcaagatcaacattgttgaca
ttttatcctttgagtgacgcataccatgggaagacaattaatatacacttaccaaatgct
tctatgaatcagagatacactttaacgatacaagaagtggaacagcaattactggttaat
gttatcttaaaagatggttcgtttttaacgttacaactacccctaagtttcctattttca
tcggccaacactctcaatggagagtggtttcatctccaaaatccctacgactttacagtt
agagttcctcatttccttttctatgtatcaccccagttctcagttgtttttttggaagat
ggcggtttgttgggtttaaaaaaagttgacggcgtacattacgagcctttactattcaat
gataattcatacttgaaaagcctaacgcgatttttttctaggagttctaaatcggattac
gatagtgtgattagttgtaaattattccatgaaagatacttaattgtgttgactcagaat
tgccacttgaaaatttgggatttaacttcatttactttaatacaagattatgatatggtt
tcacagtcagattcagacccaagccattttagaaaagtggaagctgtaggggaatacctt
tccttgtataacaatactctagttacattgttgcctttggaaaatgggctttttcaaatg
ggcaccttgttggttgattcaagcggtattttgacttatacttttcaaaataacatcccc
actaatctttcagcttctgctatttggtcaattgtagatttagttctaacgagaccattg
gagttgaatgtcgaggctagttatttaaatttgatcgttttatggaaaagtggcactgct
agcaagttacagatactaaacgtaaatgatgaaagtttcaaaaactatgaatggatagaa
tcagttaacaaatccttagtagatttgcaatccgaacatgatttggatatcgttacaaag
actggagatgttgagaggggtttctgtaatttgaaatcaagatatggtacccaaattttt
gaacgtgcacagcaaatattgagtgaaaataagattattatggctcataacgaagatgaa
gaatatttggctaatttagaaacaatattgagagacgtaaaaaccgcattcaacgaggct
tcttctataacactttatggcgatgaaattattctcgtcaattgtttccaaccgtataat
cattccctttacaagctgaatactactgtggagaattggttttataatatgcactctgaa
actgatggttctgaattgttcaagtatttaaggacattgaatggttttgcttctactttg
tcaaatgatgttcttagatccatttctaagaagtttcttgatataataacaggagagctg
cctgattctatgactaccgtagaaaaatttacggacattttcaaaaattgcctagaaaat
caatttgaaatcacaaatctaaagattcttttcgacgaattaaactcttttgatataccc
gttgttttaaatgatttaatcaataaccaaatgaagcctggtatattttggaaaaaggat
ttcatctctgcaatcaaattcgatggtttcacaagtataatttccctagaatctcttcac
cagttactttccatacattatcgtattactttacaagtattgttaacattcgttctgttc
gatcttgataccgaaattttcggacagcatatatctacattattggatttgcattataag
caatttttattgttaaacctttatagacaagataagtgtctgttggcggaagttcttctc
aaggattcttctgaattctctttcggtgtcaaattttttaactacggccaactcattgcc
tatatcgattccttaaactctaatgtttacaatgcttccatcactgaaaattctttcttt
atgacgtttttccgctcatatatcattgaaaacacatctcataagaatataaggttcttt
ctcgagaacgttgaatgccccttctacttacgccacaacgaggtgcaagaatttatgttt
gccatgacgttatttagttgtggtaatttcgatcaatcctatgaaatttttcaactacac
gattatccggaggctatcaatgataaattgccgacattcttagaagaccttaagagtgaa
aactatcacggtgatagtatatggaaagatcttttgtgcacctttacagttccatatagg
cattctgcattctattatcaattatctctcttatttgatagaaataacagccaagaattt
gctttgaaatgtatatctaagtcagcagaatattcattaaaagaaattcagattgaagaa
ctgcaagacttcaaagaaaaacagcatattcattatttaaatcttttaatccacttcaga
atgtttgaagaagtcttggatgttttgagattgggtcacgagtgtctttccgacacagta
agaacaaattttctccaattattattacaggaagacatatattcacgagattttttcagc
acacttctgcgcttgtgtaacgcacattcagacaatggcgagctatatcttcgtacagta
gatattaaaatagtggatagtattctgtcacaaaatctacggagtggtgattgggagtgt
tttaagaaactttattgttttagaatgttgaacaaaagcgagagggctgctgcagaagta
ctgtaccagtacatattaatgcaagctgatcttgatgttattcgaaagagaaaatgttac
ctaatggtcatcaacgttttatctagctttgatagtgcatacgatcaatggattctaaac
ggaagtaaagtggttactttaactgatttaagagatgagttacgaggtctatag

DBGET integrated database retrieval system