KEGG   Saccharomyces cerevisiae (budding yeast): YKL101WHelp
Entry
YKL101W           CDS       T00005                                 

Gene name
HSL1, ELM2, NIK1
Definition
Hsl1p (EC:2.7.11.- 2.7.11.1)
Orthology
K02515  
serine/threonine-protein kinase HSL1,negative regulator of Swe1 kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:248920..253476
Genome map
AA seq 1518 aa AA seqDB search
MTGHVSKTSHVPKGRPSSLAKKAAKRAMAKVNSNPKRASGHLERVVQSVNDATKRLSQPD
STVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVH
CSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALF
EVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDL
KPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWS
CGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITT
QEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDES
ILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSSSENKKSATES
SVNEPRIEYASKTANNTGLRSENNDVKTLHSLEIHSEDTSTVNQNNAITGVNTEINAPVL
AQKSQFSINTLSQPESDKAEAEAVTLPPAIPIFNASSSRIFRNSYTSISSRSRRSLRLSN
SRLSLSASTSRETVHDNEMPLPQLPKSPSRYSLSRRAIHASPSTKSIHKSLSRKNIAATV
AARRTLQNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDS
DFEILCDQILFGNALDRILEEEEDNEKERDTQRQRQNDTKSSADTFTISGVSTNKENEGP
EYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKPKRAALSDITNSFNK
MNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQHQELRVNSLPNDQGKPSLSLDPRRNISQ
PVNSKVESLLQGLKFKKEPASHWTHERGSLFMSEHVEDEKPVKASDVSIESSYVPLTTVA
TSSRDPSVLAESSTIQKPMLSLPSSFLNTSMTFKNLSQILADDGDDKHLSVPQNQSRSVA
MSHPLRKQSAKISLTPRSNLNANLSVKRNQGSPGSYLSNDLDGISDMTFAMEIPTNTFTA
QAIQLMNNDTDNNKINTSPKASSFTKEKVIKSAAYISKEKEPDNSDTNYIPDYTIPNTYD
EKAINIFEDAPSDEGSLNTSSSESDSRASVHRKAVSIDTMATTNVLTPATNVRVSLYWNN
NSSGIPRETTEEILSKLRLSPENPSNTHMQKRFSSTRGSRDSNALGISQSLQSMFKDLEE
DQDGHTSQADILESSMSYSKRRPSEESVNPKQRVTMLFDEEEEESKKVGGGKIKEEHTKL
DNKISEESSQLVLPVVEKKENANNTENNYSKIPKPSTIKVTKDTAMESNTQTHTKKPILK
SVQNVEVEEAPSSDKKNWFVKLFQNFSSHNNATKASKNHVTNISFDDAHMLTLNEFNKNS
IDYQLKNLDHKFGRKVVEYDCKFVKGNFKFKIKITSTPNASTVITVKKRSKHSNTSSNKA
FEKFNDDVERVIRNAGRS
NT seq 4557 nt NT seq  +upstreamnt  +downstreamnt
atgactggtcacgtttcaaaaacgagccacgtacccaaaggtcgcccgtcttcattggcc
aagaaggcagctaaaagggccatggccaaagtaaattcgaatccaaaaagggcgtcgggg
catttggagcgtgttgtacaatctgtgaacgacgctaccaaaagattatctcagcccgac
tctaccgtaagtgttgctacaaaatcatcaaagagaaaatccagagacacggtgggtcct
tggaaacttggcaaaacattggggaagggatcttctggtagggttcgcttggctaaaaat
atggaaacaggacaattagctgccattaaaattgtccccaagaagaaagcctttgttcat
tgttctaataatggaactgttcctaattcttactcttcttccatggtcacttccaatgta
tcttctccatcaatagcatctagagaacatagtaaccattctcaaacgaacccatatggc
atagagagagaaatagtaatcatgaaattgatatctcacacaaacgttatggcattgttt
gaagtttgggagaacaaatcagagctgtacctagttttggaatatgttgatggtggcgaa
ttattcgattatctggtctcgaagggaaagctacctgaaagggaggctatccattacttc
aagcagatagttgaaggtgtttcctattgtcattcttttaatatatgccatcgtgatctg
aagcctgaaaatttattattagataaaaagaataggagaatcaaaattgctgatttcggc
atggcagcattagagcttcctaataaacttttaaaaacttcatgtggctctccacactat
gcgtctcctgaaattgttatgggtagaccatatcatggcggtcctagcgatgtctggtcc
tgcggtatcgttttatttgcattactcaccggtcatttaccatttaatgatgacaacatc
aaaaagctgttgttgaaagttcaatcgggcaaatatcaaatgccctcaaatttatcttct
gaggctcgtgatttgatatcaaaaatattggtaattgatccagaaaaaagaattaccact
caagagatattgaagcatcctctgatcaaaaaatatgatgatctcccagttaataaagtg
ctgaggaaaatgagaaaggataacatggcgaggggaaaatctaactcggatttgcatttg
ctaaataatgtctcgccctctattgtaactttacattcaaaaggggaaattgatgaatcc
atcttgaggagtttgcaaattttgtggcatggagtttctcgtgaactaatcactgccaag
ttgcttcaaaagccaatgtcggaggaaaaactattctactcactgttattacaatataaa
caacgtcactcaatatcattgtcctcgtcaagcgaaaacaagaaatcagcaacagaaagt
agcgtaaatgaacctaggattgaatacgcatccaaaactgccaataatacaggcctaagg
agcgagaacaatgatgtgaagactttacattctctagaaattcattcagaagatacttca
acagtgaatcagaacaacgcaattacaggggttaatacagaaattaatgcccctgtattg
gcacaaaaatcgcaatttagtatcaatacgctcagtcaacctgaaagtgataaggctgaa
gcagaagctgtaacattaccacccgctattcccatattcaatgcttcttcatcaaggatt
ttccgtaactcatacacctctatttcatcacgttcgagaagatcgctacgcttatcgaat
tccagattatcattgtccgcttcaacttctagagaaactgtgcatgataatgagatgcct
ctacctcaactgccgaagtcgccttcaagatattcattgtcaagaagggcaatccacgcc
tccccatctactaaatcaatacataaatcactttcgaggaagaatatagctgcaactgtt
gccgctagaagaacactacaaaactcggcttcaaagagatccttatactcattacagtca
atttcaaaacgttccttgaacctgaatgatttattagtctttgacgatcctctccctagt
aagaaaccagcatccgaaaatgtgaataaatcagaaccccattcgttggaatcagactct
gattttgagatcttatgcgatcagatcttatttggaaacgccttagataggatactcgaa
gaggaagaggacaatgaaaaagaacgcgacacccaaagacagaggcaaaacgatacaaaa
tcttcggcagacacttttacgatctctggggtgtctacaaataaggaaaatgagggcccg
gagtatccaaccaaaattgagaaaaatcaattcaatatgtcatataaaccatctgagaat
atgtcagggctctcttcatttcctatctttgaaaaagaaaacacgttaagctcaagttat
ttggaagaacagaagccaaagagagcggccctttcagatatcacgaactcattcaataaa
atgaataaacaggaaggtatgaggatagaaaaaaagattcaaagagaacaacttcaaaaa
aaaaatgaccgcccgtcaccactcaaacctattcagcaccaagaacttcgtgtaaattct
ttgcctaatgatcaaggtaaaccgtccttatctctagatccccgccgtaacatctcccag
ccagtgaattcaaaagtggaatcactattgcagggactgaaattcaaaaaggagccagcc
tctcactggacccatgagagaggttccttgttcatgagtgaacatgtggaagacgaaaaa
ccagtcaaagcctcagatgtttcaatcgaaagttcatatgtacctttaacaacagtagca
acatcttcgagagatcccagtgttttagcagaatctagtacaattcaaaaaccaatgctg
tctttaccttctagttttttgaacacatctatgacgttcaaaaatcttagccagatactc
gctgatgacggtgatgataagcatctaagtgtgccacagaaccaatctagaagtgtagcc
atgtcacaccctttgcgaaaacaatctgccaaaatatctctaactccacggtctaatttg
aacgccaatttatccgttaaacgtaatcagggctcacctggctcctatttgagtaatgat
ctggatggaatctctgatatgacatttgcgatggaaataccaacaaacacctttaccgct
caggcgattcaactgatgaacaacgacacggacaataataaaatcaatacttcgcccaaa
gcatcttcttttacaaaagaaaaagtaatcaaatcggcagcctatatctcgaaggaaaaa
gaaccagataatagcgatactaattatattccagattatactataccaaacacatatgat
gaaaaagccattaatatttttgaagatgcgccctccgatgagggttcattaaatacatct
tcttcagaaagcgattcacgagcaagtgtgcataggaaagcggtatctattgacactatg
gcgacaacaaacgttcttactcccgcgacaaatgttagagtaagtctttattggaataat
aacagttctggtatacccagagagactactgaagagatactttctaaacttagattgtca
ccagaaaatccttctaatacacatatgcaaaagaggttttcttccacgcgtggtagtcgt
gatagtaatgcattaggcatttctcaaagtttacagtcaatgttcaaagatttggaggaa
gatcaagatgggcatacttctcaagctgatattcttgaatcaagtatgagctattcaaag
cgaagaccatctgaggaaagcgttaatccaaaacaacgagtgacaatgcttttcgatgag
gaggaggaagaatctaaaaaagtaggtgggggaaaaattaaagaagagcataccaagcta
gacaataaaatatccgaggaatcttctcaacttgtgttgccggtggttgaaaaaaaggaa
aatgcaaataatacagaaaataactactctaaaataccaaaaccctcaacgattaaagtt
acgaaggataccgctatggaatcaaatacacaaacccatacaaaaaagccaattctaaaa
agtgtccaaaatgttgaagttgaagaagcgccttccagtgataaaaagaattggttcgtc
aaactatttcaaaacttttcttctcataataatgctactaaggcatccaagaatcatgta
acgaatatatcatttgatgatgcgcatatgctaacattaaatgaattcaacaagaatagt
atcgactatcaattaaagaacctagatcacaaatttgggagaaaggtggtggaatacgat
tgtaaatttgtaaaaggcaacttcaaattcaaaatcaagattactagcacacccaatgca
tctacggtaattactgtaaaaaaaagaagcaaacattcaaacacaagttccaataaagcc
tttgaaaagtttaatgatgatgtggagagagtaattcgaaatgccggacgttcataa

DBGET integrated database retrieval system