KEGG   Saccharomyces cerevisiae (budding yeast): YKL127WHelp
Entry
YKL127W           CDS       T00005                                 

Gene name
PGM1
Definition
phosphoglucomutase PGM1 (EC:5.4.2.2)
Orthology
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YKL127W (PGM1)
   00030 Pentose phosphate pathway
    YKL127W (PGM1)
   00052 Galactose metabolism
    YKL127W (PGM1)
   00500 Starch and sucrose metabolism
    YKL127W (PGM1)
   00520 Amino sugar and nucleotide sugar metabolism
    YKL127W (PGM1)
  Nucleotide metabolism
   00230 Purine metabolism
    YKL127W (PGM1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YKL127W (PGM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:203541..205253
Genome map
AA seq 570 aa AA seqDB search
MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG
GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS
HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY
GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV
DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY
GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT
GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK
TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC
GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA
DVFLKPVINSIVKFLRFKEILGTDEPTVRT
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttctaatagattctgtaccaacagttgcttataaggaccaaaaaccgggtact
tcaggtttacgtaagaagaccaaggttttcatggatgagcctcattatactgagaacttc
attcaagcaacaatgcaatctatccctaatggctcagagggaaccactttagttgttgga
ggagatggtcgtttctacaacgatgttatcatgaacaagattgccgcagtaggtgctgca
aacggtgtcagaaagttagtcattggtcaaggcggtttactttcaacaccagctgcttct
catataattagaacatacgaggaaaagtgtaccggtggtggtatcatattaactgcctca
cacaacccaggcggtccagagaatgatttaggtatcaagtataatttacctaatggtggg
ccagctccagagagtgtcactaacgctatctgggaagcgtctaaaaaattaactcactat
aaaattataaagaacttccccaagttgaatttgaacaagcttggtaaaaaccaaaaatat
ggcccattgttagtggacataattgatcctgccaaagcatacgttcaatttctgaaggaa
atttttgattttgacttaattaaaagcttcttagcgaaacagcgcaaagacaaagggtgg
aagttgttgtttgactccttaaatggtattacaggaccatatggtaaggctatatttgtt
gatgaatttggtttaccggcagaggaagttcttcaaaattggcaccctttacctgatttc
ggcggtttacatcccgatccgaatctaacctatgcacgaactcttgttgacagggttgac
cgcgaaaaaattgcctttggagcagcctccgatggtgatggtgataggaatatgatttac
ggttatggccctgctttcgtttcgccaggtgattctgttgccattattgccgaatatgca
cccgaaattccatacttcgccaaacaaggtatttatggcttggcacgttcatttcctaca
tcctcagccattgatcgtgttgcagcaaaaaagggattaagatgttacgaagttccaacc
ggctggaaattcttctgtgccttatttgatgctaaaaagctatcaatctgtggtgaagaa
tccttcggtacaggttccaatcatatcagagaaaaggacggtctatgggccattattgct
tggttaaatatcttggctatctaccataggcgtaaccctgaaaaggaagcttcgatcaaa
actattcaggacgaattttggaacgagtatggccgtactttcttcacaagatacgattac
gaacatatcgaatgcgagcaggccgaaaaagttgtagctcttttgagtgaatttgtatca
aggccaaacgtttgtggctcccacttcccagctgatgagtctttaaccgttatcgattgt
ggtgatttttcgtatagagatctagatggctccatctctgaaaatcaaggccttttcgta
aagttttcgaatgggactaaatttgttttgaggttatccggcacaggcagttctggtgca
acaataagattatacgtagaaaagtatactgataaaaaggagaactatggccaaacagct
gacgtcttcttgaaacccgtcatcaactccattgtaaaattcttaagatttaaagaaatt
ttaggaacagacgaaccaacagtccgcacatag

DBGET integrated database retrieval system