KEGG   Saccharomyces cerevisiae (budding yeast): YKL127WHelp
Entry
YKL127W           CDS       T00005                                 

Gene name
PGM1
Definition
(RefSeq) phosphoglucomutase PGM1
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00030  Pentose phosphate pathway
sce00052  Galactose metabolism
sce00230  Purine metabolism
sce00500  Starch and sucrose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Module
sce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YKL127W (PGM1)
   00030 Pentose phosphate pathway
    YKL127W (PGM1)
   00052 Galactose metabolism
    YKL127W (PGM1)
   00500 Starch and sucrose metabolism
    YKL127W (PGM1)
   00520 Amino sugar and nucleotide sugar metabolism
    YKL127W (PGM1)
  Nucleotide metabolism
   00230 Purine metabolism
    YKL127W (PGM1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YKL127W (PGM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 853732
NCBI-ProteinID: NP_012795
SGD: S000001610
UniProt: P33401
Position
XI:203541..205253
Genome map
AA seq 570 aa AA seqDB search
MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG
GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS
HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY
GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV
DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY
GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT
GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK
TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC
GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA
DVFLKPVINSIVKFLRFKEILGTDEPTVRT
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttctaatagattctgtaccaacagttgcttataaggaccaaaaaccgggtact
tcaggtttacgtaagaagaccaaggttttcatggatgagcctcattatactgagaacttc
attcaagcaacaatgcaatctatccctaatggctcagagggaaccactttagttgttgga
ggagatggtcgtttctacaacgatgttatcatgaacaagattgccgcagtaggtgctgca
aacggtgtcagaaagttagtcattggtcaaggcggtttactttcaacaccagctgcttct
catataattagaacatacgaggaaaagtgtaccggtggtggtatcatattaactgcctca
cacaacccaggcggtccagagaatgatttaggtatcaagtataatttacctaatggtggg
ccagctccagagagtgtcactaacgctatctgggaagcgtctaaaaaattaactcactat
aaaattataaagaacttccccaagttgaatttgaacaagcttggtaaaaaccaaaaatat
ggcccattgttagtggacataattgatcctgccaaagcatacgttcaatttctgaaggaa
atttttgattttgacttaattaaaagcttcttagcgaaacagcgcaaagacaaagggtgg
aagttgttgtttgactccttaaatggtattacaggaccatatggtaaggctatatttgtt
gatgaatttggtttaccggcagaggaagttcttcaaaattggcaccctttacctgatttc
ggcggtttacatcccgatccgaatctaacctatgcacgaactcttgttgacagggttgac
cgcgaaaaaattgcctttggagcagcctccgatggtgatggtgataggaatatgatttac
ggttatggccctgctttcgtttcgccaggtgattctgttgccattattgccgaatatgca
cccgaaattccatacttcgccaaacaaggtatttatggcttggcacgttcatttcctaca
tcctcagccattgatcgtgttgcagcaaaaaagggattaagatgttacgaagttccaacc
ggctggaaattcttctgtgccttatttgatgctaaaaagctatcaatctgtggtgaagaa
tccttcggtacaggttccaatcatatcagagaaaaggacggtctatgggccattattgct
tggttaaatatcttggctatctaccataggcgtaaccctgaaaaggaagcttcgatcaaa
actattcaggacgaattttggaacgagtatggccgtactttcttcacaagatacgattac
gaacatatcgaatgcgagcaggccgaaaaagttgtagctcttttgagtgaatttgtatca
aggccaaacgtttgtggctcccacttcccagctgatgagtctttaaccgttatcgattgt
ggtgatttttcgtatagagatctagatggctccatctctgaaaatcaaggccttttcgta
aagttttcgaatgggactaaatttgttttgaggttatccggcacaggcagttctggtgca
acaataagattatacgtagaaaagtatactgataaaaaggagaactatggccaaacagct
gacgtcttcttgaaacccgtcatcaactccattgtaaaattcttaagatttaaagaaatt
ttaggaacagacgaaccaacagtccgcacatag

DBGET integrated database retrieval system