KEGG   Saccharomyces cerevisiae (budding yeast): YKL150WHelp
Entry
YKL150W           CDS       T00005                                 

Gene name
MCR1
Definition
(RefSeq) cytochrome-b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YKL150W (MCR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     YKL150W (MCR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 853707
NCBI-ProteinID: NP_012772
SGD: S000001633
UniProt: P36060
Position
XI:166544..167452
Genome map
AA seq 302 aa AA seqDB search
MFSRLSRSHSKALPIALGTVAIAAATAFYFANRNQHSFVFNESNKVFKGDDKWIDLPISK
IEEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVSDLSQKGHFQL
VVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHH
IVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEIS
FISKDFIQEHVPGPKESTHLFVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKDQVF
KF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagattatccagatctcactcaaaagcattaccgattgctctaggtacagtt
gctatagcagctgctaccgcattctattttgcaaaccgtaaccaacattcctttgtcttc
aatgaatctaataaagtgttcaaaggtgatgacaaatggatcgacttgccaatatctaaa
atagaggaggaatcccacgacaccagaaggtttacttttaagctgcctaccgaagactca
gaaatggggttggtcctagcatctgctctgtttgctaaatttgtcacaccaaagggatcc
aatgtggtgagaccatacactcctgtgagtgatctttcccagaagggtcacttccagctg
gtcgtcaagcattatgaaggtggtaaaatgacctcacatttatttggtcttaaaccaaat
gacaccgtttctttcaagggtcctattatgaaatggaagtggcaacctaatcagttcaag
tcaatcaccttgttaggtgccggtaccggtatcaaccctctgtaccaattagctcatcat
atagttgaaaacccaaacgacaagaccaaagttaacttgctatatgggaacaagactcct
caggacattttactaaggaaggaactggatgcgttgaaggaaaagtatcctgacaagttc
aatgttacttactttgttgacgacaagcaagatgaccaagactttgatggtgaaattagt
ttcatctccaaagattttattcaggagcatgttccaggtccaaaggaaagcacacatttg
tttgtctgcggtcccccaccatttatgaacgcttactcaggtgagaagaagtcacctaag
gaccaaggtgaattgatcggtatcttgaacaatttgggctactccaaggaccaagttttc
aaattttaa

DBGET integrated database retrieval system