KEGG   Saccharomyces cerevisiae (budding yeast): YKL150WHelp
Entry
YKL150W           CDS       T00005                                 

Gene name
MCR1
Definition
Mcr1p (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YKL150W (MCR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     YKL150W (MCR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:166544..167452
Genome map
AA seq 302 aa AA seqDB search
MFSRLSRSHSKALPIALGTVAIAAATAFYFANRNQHSFVFNESNKVFKGDDKWIDLPISK
IEEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVSDLSQKGHFQL
VVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHH
IVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEIS
FISKDFIQEHVPGPKESTHLFVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKDQVF
KF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagattatccagatctcactcaaaagcattaccgattgctctaggtacagtt
gctatagcagctgctaccgcattctattttgcaaaccgtaaccaacattcctttgtcttc
aatgaatctaataaagtgttcaaaggtgatgacaaatggatcgacttgccaatatctaaa
atagaggaggaatcccacgacaccagaaggtttacttttaagctgcctaccgaagactca
gaaatggggttggtcctagcatctgctctgtttgctaaatttgtcacaccaaagggatcc
aatgtggtgagaccatacactcctgtgagtgatctttcccagaagggtcacttccagctg
gtcgtcaagcattatgaaggtggtaaaatgacctcacatttatttggtcttaaaccaaat
gacaccgtttctttcaagggtcctattatgaaatggaagtggcaacctaatcagttcaag
tcaatcaccttgttaggtgccggtaccggtatcaaccctctgtaccaattagctcatcat
atagttgaaaacccaaacgacaagaccaaagttaacttgctatatgggaacaagactcct
caggacattttactaaggaaggaactggatgcgttgaaggaaaagtatcctgacaagttc
aatgttacttactttgttgacgacaagcaagatgaccaagactttgatggtgaaattagt
ttcatctccaaagattttattcaggagcatgttccaggtccaaaggaaagcacacatttg
tttgtctgcggtcccccaccatttatgaacgcttactcaggtgagaagaagtcacctaag
gaccaaggtgaattgatcggtatcttgaacaatttgggctactccaaggaccaagttttc
aaattttaa

DBGET integrated database retrieval system