KEGG   Saccharomyces cerevisiae (budding yeast): YKL161CHelp
Entry
YKL161C           CDS       T00005                                 

Gene name
KDX1, MLP1
Definition
Kdx1p (EC:2.7.11.1)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YKL161C (KDX1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   YKL161C (KDX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(149386..150687)
Genome map
AA seq 433 aa AA seqDB search
MATDTERCIFRAFGQDFILNKHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAF
GNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIR
SEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSE
NHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVD
HLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILPGANPEALELLKKMLE
FDPKKRITVEDALEHPYLSMWHDIDEEFSCQKTFRFEFEHIESMAELGNEVIKEVFDFRK
VVRKHPISGDSPSSSLSLEDAIPQEVVQVHPSRKVLPSYSPEFSYVSQLPSLTTTQPYQN
LMGISSNSFQGVN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgacaccgagaggtgtattttccgtgcattcggccaagattttatcctaaat
aaacattttcatttgacaggtaagattggtcggggctcacacagccttatttgttcttca
acttacacagaatcgaacgaggaaactcacgtggctatcagaaaaataccaaacgcgttt
ggcaataaactatcttgcaagagaactcttcgtgaattgaaactactaagacatttaaga
gggcacccaaatatagtgtggctcttcgatactgatatagtattttacccaaatggggca
ctaaatggcgtttatttatatgaagaactaatggaatgtgacctttctcaaattataagg
tccgaacaacgcctggaagacgcacactttcaaagcttcatatatcagatactgtgtgct
ctgaaatacatacattctgctaatgttttacattgtgacctgaaaccaaaaaacttactt
gttaatagtgattgccaactaaaaatttgtaattttgggctatcgtgtagttattcagaa
aaccacaaggttaacgacggcttcattaagggttatataacctcgatatggtataaagca
ccagaaattttgctgaattatcaagaatgcacaaaagctgtcgatatttggtcaacaggc
tgtatcttggccgaactacttggtaggaaaccaatgtttgaagggaaggattatgtagat
catttgaatcatattctacaaatacttggaacaccacctgaggaaacattgcaggaaatt
gcctctcaaaaggtgtataattatatctttcagttcggtaatatcccgggaagatcgttt
gaaagcatactacctggtgctaatccagaagcgcttgaattgctaaagaaaatgctagaa
tttgatcctaaaaaaaggattactgtagaggatgcactagagcatccatatttgtcaatg
tggcatgatatagatgaggaattctcatgtcaaaagacctttagattcgaattcgagcat
atcgaaagtatggcggaattaggaaacgaagttataaaggaagtatttgatttcaggaaa
gttgttagaaaacatcctattagcggtgattccccatcatcatcactatctttagaggat
gccattcctcaagaagttgtacaggtccatccttctaggaaagttttacccagttatagt
cctgaattttcctatgtaagccaacttccatcactaactacaacccagccatatcaaaac
cttatgggaataagctctaattcatttcagggtgttaactaa

DBGET integrated database retrieval system