KEGG   Saccharomyces cerevisiae (budding yeast): YKL161CHelp
Entry
YKL161C           CDS       T00005                                 

Gene name
KDX1, MLP1
Definition
(RefSeq) putative protein kinase KDX1 (EC:2.7.11.1)
  KO
K19847  
MPK-like protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YKL161C (KDX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(149386..150687)
Genome map
AA seq 433 aa AA seqDB search
MATDTERCIFRAFGQDFILNKHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAF
GNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIR
SEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSE
NHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVD
HLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILPGANPEALELLKKMLE
FDPKKRITVEDALEHPYLSMWHDIDEEFSCQKTFRFEFEHIESMAELGNEVIKEVFDFRK
VVRKHPISGDSPSSSLSLEDAIPQEVVQVHPSRKVLPSYSPEFSYVSQLPSLTTTQPYQN
LMGISSNSFQGVN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgacaccgagaggtgtattttccgtgcattcggccaagattttatcctaaat
aaacattttcatttgacaggtaagattggtcggggctcacacagccttatttgttcttca
acttacacagaatcgaacgaggaaactcacgtggctatcagaaaaataccaaacgcgttt
ggcaataaactatcttgcaagagaactcttcgtgaattgaaactactaagacatttaaga
gggcacccaaatatagtgtggctcttcgatactgatatagtattttacccaaatggggca
ctaaatggcgtttatttatatgaagaactaatggaatgtgacctttctcaaattataagg
tccgaacaacgcctggaagacgcacactttcaaagcttcatatatcagatactgtgtgct
ctgaaatacatacattctgctaatgttttacattgtgacctgaaaccaaaaaacttactt
gttaatagtgattgccaactaaaaatttgtaattttgggctatcgtgtagttattcagaa
aaccacaaggttaacgacggcttcattaagggttatataacctcgatatggtataaagca
ccagaaattttgctgaattatcaagaatgcacaaaagctgtcgatatttggtcaacaggc
tgtatcttggccgaactacttggtaggaaaccaatgtttgaagggaaggattatgtagat
catttgaatcatattctacaaatacttggaacaccacctgaggaaacattgcaggaaatt
gcctctcaaaaggtgtataattatatctttcagttcggtaatatcccgggaagatcgttt
gaaagcatactacctggtgctaatccagaagcgcttgaattgctaaagaaaatgctagaa
tttgatcctaaaaaaaggattactgtagaggatgcactagagcatccatatttgtcaatg
tggcatgatatagatgaggaattctcatgtcaaaagacctttagattcgaattcgagcat
atcgaaagtatggcggaattaggaaacgaagttataaaggaagtatttgatttcaggaaa
gttgttagaaaacatcctattagcggtgattccccatcatcatcactatctttagaggat
gccattcctcaagaagttgtacaggtccatccttctaggaaagttttacccagttatagt
cctgaattttcctatgtaagccaacttccatcactaactacaacccagccatatcaaaac
cttatgggaataagctctaattcatttcagggtgttaactaa

DBGET integrated database retrieval system