KEGG   Saccharomyces cerevisiae (budding yeast): YKL166CHelp
Entry
YKL166C           CDS       T00005                                 

Gene name
TPK3
Definition
Tpk3p (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YKL166C (TPK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YKL166C (TPK3)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YKL166C (TPK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(134509..135705)
Genome map
AA seq 398 aa AA seqDB search
MYVDPMNNNEIRKLSITAKTETTPDNVGQDIPVNAHSVHEECSSNTPVEINGRNSGKLKE
EASAGICLVKKPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLK
KHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKS
QRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT
YTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAEL
KFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYE
PPIQQGQGDTSQFDRYPEEEFNYGIQGEDPYMDLMKEF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgatccgatgaacaacaatgaaatcaggaaattaagcattactgccaagaca
gaaacaactccagataacgttggacaagacattcctgtaaacgcacattcggtgcatgag
gaatgttcttccaacacacccgtggagataaatggaagaaacagcggaaagttgaaagaa
gaagcgtctgcaggtatttgtttggttaaaaaaccaatgctacaatatagagatacctca
ggaaagtattccctaagtgactttcagattttaagaactttgggaactggctcatttggg
agagttcacctaattcgttccaatcacaatgggaggttttacgctttgaagacattgaaa
aagcacactatagtgaagctgaagcaggttgaacacaccaatgacgaacgccgaatgctt
tcaattgtttcacatccattcatcattcgaatgtggggaacgttccaagattctcagcaa
gttttcatggtaatggactacattgaaggtggtgaattattttctttactacgtaaatct
caaagatttcccaacccagtagccaaattttatgccgcagaggtatgcttagcgttggaa
tatttgcacagtaaggatataatatatagagacttgaaaccagaaaatatccttctagat
aaaaacggccatatcaagataaccgactttggcttcgcaaaatacgttcccgatgtcaca
tacacattatgtggcacaccagattacatagcgccggaagtggtcagtacaaaaccgtat
aataaatcagtggattggtggagttttggtgtgctaatctatgaaatgcttgccggatac
actccattttacaattcgaacaccatgaaaacttacgaaaatatactgaacgccgaattg
aagttcccaccatttttccatccagacgcgcaggacttattgaagaagctaattaccaga
gacttaagtgaaaggttgggtaacttacaaaatggaagtgaagatgtcaagaaccatccg
tggtttaacgaagtgatatgggagaaattgttagcaagatacatagaaacgccgtacgaa
ccaccaatccaacagggccaaggtgacacttctcaatttgacagataccctgaagaggaa
ttcaactatggaattcaaggggaggatccatatatggatttaatgaaagaattttaa

DBGET integrated database retrieval system