KEGG   Saccharomyces cerevisiae (budding yeast): YKL166CHelp
Entry
YKL166C           CDS       T00005                                 

Gene name
TPK3
Definition
cAMP-dependent protein kinase catalytic subunit TPK3 (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YKL166C (TPK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YKL166C (TPK3)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YKL166C (TPK3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YKL166C (TPK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(134509..135705)
Genome map
AA seq 398 aa AA seqDB search
MYVDPMNNNEIRKLSITAKTETTPDNVGQDIPVNAHSVHEECSSNTPVEINGRNSGKLKE
EASAGICLVKKPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLK
KHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKS
QRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT
YTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAEL
KFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYE
PPIQQGQGDTSQFDRYPEEEFNYGIQGEDPYMDLMKEF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgatccgatgaacaacaatgaaatcaggaaattaagcattactgccaagaca
gaaacaactccagataacgttggacaagacattcctgtaaacgcacattcggtgcatgag
gaatgttcttccaacacacccgtggagataaatggaagaaacagcggaaagttgaaagaa
gaagcgtctgcaggtatttgtttggttaaaaaaccaatgctacaatatagagatacctca
ggaaagtattccctaagtgactttcagattttaagaactttgggaactggctcatttggg
agagttcacctaattcgttccaatcacaatgggaggttttacgctttgaagacattgaaa
aagcacactatagtgaagctgaagcaggttgaacacaccaatgacgaacgccgaatgctt
tcaattgtttcacatccattcatcattcgaatgtggggaacgttccaagattctcagcaa
gttttcatggtaatggactacattgaaggtggtgaattattttctttactacgtaaatct
caaagatttcccaacccagtagccaaattttatgccgcagaggtatgcttagcgttggaa
tatttgcacagtaaggatataatatatagagacttgaaaccagaaaatatccttctagat
aaaaacggccatatcaagataaccgactttggcttcgcaaaatacgttcccgatgtcaca
tacacattatgtggcacaccagattacatagcgccggaagtggtcagtacaaaaccgtat
aataaatcagtggattggtggagttttggtgtgctaatctatgaaatgcttgccggatac
actccattttacaattcgaacaccatgaaaacttacgaaaatatactgaacgccgaattg
aagttcccaccatttttccatccagacgcgcaggacttattgaagaagctaattaccaga
gacttaagtgaaaggttgggtaacttacaaaatggaagtgaagatgtcaagaaccatccg
tggtttaacgaagtgatatgggagaaattgttagcaagatacatagaaacgccgtacgaa
ccaccaatccaacagggccaaggtgacacttctcaatttgacagataccctgaagaggaa
ttcaactatggaattcaaggggaggatccatatatggatttaatgaaagaattttaa

DBGET integrated database retrieval system