KEGG   Saccharomyces cerevisiae (budding yeast): YKL190WHelp
Entry
YKL190W           CDS       T00005                                 

Gene name
CNB1, CRV1, YCN2
Definition
Cnb1p
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     YKL190W (CNB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:join(82947..82998,83075..83550)
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKIVDGLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVLK
IMVGSNLDDEQLQQIVDRTIVENDSDGDGRLSFEEFKNAIETTEVAKSLTLQYDV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgctccttccaaaattgtggatggtcttttagaagatacaaattttgataga
gatgaaattgaaaggttaaggaagagattcatgaaattagatagagatagctcagggtct
attgataaaaatgaatttatgagcattcctggcgtttcgtcaaaccctcttgctggacgt
ataatggaggttttcgatgctgataatagtggggacgtggattttcaagagttcatcaca
ggattatccattttcagtgggcgtgggtccaaggacgaaaagttaagattcgccttcaaa
atctacgacattgacaaggacggtttcatatccaatggtgagttgttcatcgtgttgaag
attatggtaggttctaatctggacgatgaacagctgcaacagatagtagataggacgata
gtggaaaacgatagcgacggcgacggacgtttaagtttcgaggagtttaagaatgctatc
gaaaccacagaagtggccaagagtctgacattgcaatacgatgtgtaa

DBGET integrated database retrieval system