KEGG   Saccharomyces cerevisiae (budding yeast): YKL203CHelp
Entry
YKL203C           CDS       T00005                                 

Gene name
TOR2, DRR2
Definition
phosphatidylinositol kinase-related protein kinase TOR2 (EC:2.7.11.1 2.7.1.67)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YKL203C (TOR2)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   YKL203C (TOR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(55935..63359)
Genome map
AA seq 2474 aa AA seqDB search
MNKYINKYTTPPNLLSLRQRAEGKHRTRKKLTHKSHSHDDEMSTTSNTDSNHNGPNDSGR
VITGSAGHIGKISFVDSELDTTFSTLNLIFDKLKSDVPQERASGANELSTTLTSLAREVS
AEQFQRFSNSLNNKIFELIHGFTSSEKIGGILAVDTLISFYLSTEELPNQTSRLANYLRV
LIPSSDIEVMRLAANTLGRLTVPGGTLTSDFVEFEVRTCIDWLTLTADNNSSSSKLEYRR
HAALLIIKALADNSPYLLYPYVNSILDNIWVPLRDAKLIIRLDAAVALGKCLTIIQDRDP
ALGKQWFQRLFQGCTHGLSLNTNDSVHATLLVFRELLSLKAPYLRDKYDDIYKSTMKYKE
YKFDVIRREVYAILPLLAAFDPAIFTKKYLDRIMVHYLRYLKNIDMNAANNSDKPFILVS
IGDIAFEVGSSISPYMTLILDNIREGLRTKFKVRKQFEKDLFYCIGKLACALGPAFAKHL
NKDLLNLMLNCPMSDHMQETLMILNEKIPSLESTVNSRILNLLSISLSGEKFIQSNQYDF
NNQFSIEKARKSRNQSFMKKTGESNDDITDAQILIQCFKMLQLIHHQYSLTEFVRLITIS
YIEHEDSSVRKLAALTSCDLFIKDDICKQTSVHALHSVSEVLSKLLMIAITDPVAEIRLE
ILQHLGSNFDPQLAQPDNLRLLFMALNDEIFGIQLEAIKIIGRLSSVNPAYVVPSLRKTL
LELLTQLKFSNMPKKKEESATLLCTLINSSDEVAKPYIDPILDVILPKCQDASSAVASTA
LKVLGELSVVGGKEMTRYLKELMPLIINTFQDQSNSFKRDAALTTLGQLAASSGYVVGPL
LDYPELLGILINILKTENNPHIRRGTVRLIGILGALDPYKHREIEVTSNSKSSVEQNAPS
IDIALLMQGVSPSNDEYYPTVVIHNLMKILNDPSLSIHHTAAIQAIMHIFQNLGLRCVSF
LDQIIPGIILVMRSCPPSQLDFYFQQLGSLISIVKQHIRPHVEKIYGVIREFFPIIKLQI
TIISVIESISKALEGEFKRFVPETLTFFLDILENDQSNKRIVPIRILKSLVTFGPNLEDY
SHLIMPIVVRMTEYSAGSLKKISIITLGRLAKNINLSEMSSRIVQALVRILNNGDRELTK
ATMNTLSLLLLQLGTDFVVFVPVINKALLRNRIQHSVYDQLVNKLLNNECLPTNIIFDKE
NEVPERKNYEDEMQVTKLPVNQNILKNAWYCSQQKTKEDWQEWIRRLSIQLLKESPSACL
RSCSSLVSVYYPLARELFNASFSSCWVELQTSYQEDLIQALCKALSSSENPPEIYQMLLN
LVEFMEHDDKPLPIPIHTLGKYAQKCHAFAKALHYKEVEFLEEPKNSTIEALISINNQLH
QTDSAIGILKHAQQHNELQLKETWYEKLQRWEDALAAYNEKEAAGEDSVEVMMGKLRSLY
ALGEWEELSKLASEKWGTAKPEVKKAMAPLAAGAAWGLEQWDEIAQYTSVMKSQSPDKEF
YDAILCLHRNNFKKAEVHIFNARDLLVTELSALVNESYNRAYNVVVRAQIIAELEEIIKY
KKLPQNSDKRLTMRETWNTRLLGCQKNIDVWQRILRVRSLVIKPKEDAQVRIKFANLCRK
SGRMALAKKVLNTLLEETDDPDHPNTAKASPPVVYAQLKYLWATGLQDEALKQLINFTSR
MAHDLGLDPNNMIAQSVPQQSKRVPRHVEDYTKLLARCFLKQGEWRVCLQPKWRLSNPDS
ILGSYLLATHFDNTWYKAWHNWALANFEVISMLTSVSKKKQEGSDASSVTDINEFDNGMI
GVNTFDAKEVHYSSNLIHRHVIPAIKGFFHSISLSESSSLQDALRLLTLWFTFGGIPEAT
QAMHEGFNLIQIGTWLEVLPQLISRIHQPNQIVSRSLLSLLSDLGKAHPQALVYPLMVAI
KSESLSRQKAALSIIEKMRIHSPVLVDQAELVSHELIRMAVLWHEQWYEGLDDASRQFFG
EHNTEKMFAALEPLYEMLKRGPETLREISFQNSFGRDLNDAYEWLMNYKKSKDVSNLNQA
WDIYYNVFRKIGKQLPQLQTLELQHVSPKLLSAHDLELAVPGTRASGGKPIVKISKFEPV
FSVISSKQRPRKFCIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLQNDAECFRRH
LDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLT
LLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDR
HPSNLMLDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRIT
CENVMKVLRDNKGSLMAILEAFAFDPLINWGFDLPTKKIEEETGIQLPVMNANELLSNGA
ITEEEVQRVENEHKNAIRNARAMLVLKRITDKLTGNDIRRFNDLDVPEQVDKLIQQATSV
ENLCQHYIGWCPFW
NT seq 7425 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatacattaacaaatacaccacgccacctaacttattgtctttacgacaaagg
gccgaaggcaaacacagaacaagaaagaaacttacacacaaatcgcactcccacgatgat
gagatgtcaactacttcaaacacagattccaatcacaatgggcccaatgactctggtaga
gtgatcactggttctgctggtcatattggtaaaatatcctttgtagattcagaactagat
acaacattttctactttaaatttgatttttgataaacttaaaagcgatgtgccacaagaa
cgagcctctggcgctaatgaattaagcactactttgacctcattagcaagggaagtatct
gctgagcaatttcaaaggtttagcaacagtttaaacaataagatatttgaacttattcac
gggtttacttcaagtgagaagataggtggtattcttgctgttgatactctgatctcattc
tacctgagtacagaggagctgccaaaccaaacttcaagactggcgaactatttacgtgtt
ttaattccatccagtgacattgaagttatgagattagcggctaacaccttaggtagattg
accgtgccaggtggtacattaacatcagatttcgtcgaatttgaggtcagaacttgcatt
gattggcttactctgacagcagataataactcatcgagctctaagttggaatacaggaga
catgctgcgctattaatcataaaggcattagcagacaattcaccctatcttttataccct
tacgttaactctatcttagacaatatttgggtgccattaagggatgcaaagttaattata
cgattagatgccgcagtggcattgggtaaatgtcttactattattcaggatagagaccct
gctttgggaaaacagtggtttcaaagattatttcaaggttgtacacatggcttaagtctc
aatacgaatgattcagtgcatgctactctgttggtatttcgagaattactcagcttgaaa
gcaccttatctcagggataaatatgatgatatttacaaatctactatgaagtacaaggaa
tataaatttgatgttataaggagagaagtttatgctattttacctcttttagctgctttt
gaccctgccattttcacaaagaaatatctcgataggataatggttcattatttaagatat
ttgaagaacatcgatatgaatgctgcaaataattcggataaaccttttatattagtttct
ataggtgatattgcatttgaagttggttcgagcatttcaccctatatgacacttattctg
gataatattagggaaggcttaagaacgaaattcaaagttagaaaacaattcgagaaggat
ttattttattgcattggtaaattagcttgtgctttgggcccagcttttgctaagcacttg
aacaaagatcttcttaatttgatgttaaactgtccaatgtccgaccatatgcaggagact
ttaatgatccttaacgagaaaataccctctttggaatctaccgttaattcgaggatacta
aatttactgtcgatatccttatctggtgaaaaatttattcaatcaaaccaatacgatttt
aataatcaattttccattgaaaaggctcgtaaatcaagaaaccaaagtttcatgaaaaaa
actggtgaatctaatgacgatattacagatgcccaaattttgattcagtgttttaaaatg
ctgcaactaattcatcatcaatattccttgacggagtttgttaggcttataaccatttct
tacattgagcatgaggattcgtctgtcagaaaattggcagcattaacgtcgtgtgattta
tttatcaaagacgatatatgtaaacaaacatcagttcatgctttacactcggtttctgaa
gtgctaagtaagctattaatgatcgcaataactgatccggttgcagaaattagattggaa
attcttcagcatttggggtcaaattttgatcctcaattggcccaaccagacaatttacgc
ctacttttcatggcgctgaacgatgagatttttggtattcaattggaagctatcaaaata
ataggcagattgagttctgtcaaccccgcttatgtagttccttctttgaggaaaacttta
ctggaactattaacgcaattgaagttctcaaatatgccaaaaaaaaaggaggaaagtgca
actctattatgtacgctgataaattccagcgatgaagtagcgaaaccttatattgatcct
attctagacgtcattcttcctaaatgccaggatgcttcatctgccgtagcatccaccgct
ttaaaggttttgggtgaactatctgttgttggaggaaaagaaatgacgcgttacttaaag
gaattgatgccattgatcattaacacatttcaggaccaatcaaactcttttaaaagagat
gccgccttaacaacattaggacagctggctgcttcctctggttatgttgttggcccttta
ctagactacccagagttacttggcattttgataaatattcttaagactgaaaacaaccct
catatcaggcgtggaactgttcgtttgattggtatattaggcgctcttgatccatataag
cacagagaaatagaagtcacatcaaactcaaagagttcagtagagcaaaatgctccttca
atcgacatcgcattgctaatgcaaggggtatctccatccaacgatgaatattaccccact
gtagttatccacaatctgatgaagatattgaatgatccatcgttgtcaatccatcacacg
gctgctattcaagctattatgcatatttttcaaaaccttggtttacgatgtgtctccttt
ttggatcaaattattccaggtatcattttagtcatgcgttcatgcccgccgtcccaactt
gacttttattttcagcaactgggatctctcatctcaattgtcaagcaacatattaggccc
catgtcgagaaaatttatggtgtgatcagggagtttttcccgatcattaaactacaaatc
acaattatttctgtcatagaatcgatatctaaggctctggaaggtgagtttaaaagattt
gttcccgagactctaacctttttccttgatattcttgagaacgaccagtctaataaaagg
atcgttccgattcgtatattaaaatctttggttacttttgggccgaatctagaagactat
tcccatttgattatgcctatcgttgttagaatgactgagtattctgctggaagtctaaag
aaaatctccattataactttgggtagattagcaaagaatatcaacctctctgaaatgtca
tcaagaattgttcaggcgttggtaagaattttgaataatggggatagagaactaacaaaa
gcaaccatgaatacgctaagtttgctccttttacaactaggtaccgactttgtggtcttt
gtgccagtgattaacaaggcgttattgaggaataggattcagcattcagtgtacgatcaa
ctggttaataaattactgaacaatgaatgcttgccaacaaatatcatatttgacaaggag
aacgaagtacctgaaaggaaaaattatgaagacgaaatgcaagtaacgaaattaccggta
aaccaaaatatcctaaagaatgcatggtattgttctcaacagaagaccaaagaagattgg
caagaatggataagaaggctatctattcagcttctaaaggaatcaccttcagcttgtcta
cgatcctgttcgagtttagtcagcgtttattatccgttggcgagagaattgtttaatgct
tcattctcaagttgctgggttgagcttcaaacgtcataccaagaggatttgattcaagca
ttatgcaaggctttatcatcctctgaaaacccacccgagatttatcaaatgttgttaaat
ttagtggaatttatggagcacgatgacaaaccattgcctatcccaatccatacattaggt
aagtatgcccaaaaatgtcatgcttttgcgaaggcactacattacaaagaggtagaattc
ttagaagagccgaaaaattcaacaatcgaggcattgattagcattaataatcaacttcac
caaactgattctgctattggtattttgaagcatgcgcaacaacacaatgaattgcagctg
aaggaaacttggtatgaaaaacttcaacgttgggaggatgctcttgcagcatataatgag
aaggaggcagcaggagaagattcggttgaagtgatgatgggaaaattaagatcgttatat
gcccttggagagtgggaagagctttctaaattggcatctgaaaagtggggcacggcaaaa
cccgaagtgaagaaggcaatggcgcctttggctgccggcgctgcctggggtttggagcaa
tgggatgaaatagcccagtatactagcgtcatgaaatcgcagtctccagataaagaattc
tatgatgcaattttatgtttgcataggaataattttaagaaggcggaagttcacatcttt
aatgcaagggatcttctagttactgaattgtcagctcttgttaatgaaagctacaataga
gcatataatgttgttgttagagcgcagattatagcagagttggaggaaatcatcaaatat
aagaagttgccacaaaattcagataaacgtctaactatgagagaaacttggaataccaga
ttactgggctgtcaaaaaaatattgatgtgtggcaaagaattctgcgtgtcagatcattg
gtgataaagccaaaggaggatgctcaagtgaggattaagtttgccaacttatgcagaaaa
tcgggtaggatggcgctagctaaaaaagtcttaaatacattgcttgaagaaacagatgac
ccagatcatcctaatactgctaaggcatcccctccagttgtttatgcacaactgaagtac
ttgtgggctacggggttgcaagatgaggctttgaagcaattaattaatttcacatctaga
atggctcatgatttaggtttggatccaaataatatgatagctcaaagcgttcctcaacaa
agcaaaagagtccctcgtcacgttgaagattatactaagcttttagctcgttgtttcttg
aagcaaggagaatggagagtttgcttacagcctaaatggagattgagcaatccagattcg
atcctaggctcctatttgctcgctacacattttgacaacacatggtacaaagcgtggcat
aactgggcactggccaattttgaagtcatttctatgctaacatctgtctctaaaaagaaa
caggaaggaagtgatgcttcctcggtaactgatattaatgagtttgataatggcatgatc
ggcgtcaatacatttgatgctaaggaagttcattactcttctaatttaatacacaggcac
gtaattccagcaattaagggtttttttcattccatttctttatcagaatcaagctctctt
caagatgcattaaggttattaactttatggtttacttttggtggtattccagaagcaacc
caagctatgcacgagggtttcaacctaatccaaataggcacatggttagaagtgttgcca
cagttaatttctagaattcatcaacccaatcaaattgttagtaggtcattactctcccta
ttatctgatctaggtaaggctcatccgcaggcattagtgtaccccttaatggttgcgatt
aaatccgaatctctctcacgacagaaagcagctttgtccatcatagaaaagatgagaata
catagtccagttttggtcgaccaggctgaacttgtcagccacgaattgatacgtatggcg
gtgctttggcatgagcaatggtatgagggtctggatgacgccagtaggcagttttttgga
gaacataataccgaaaaaatgtttgctgctttagagcctctgtacgaaatgctgaagaga
ggaccggaaactttgagggaaatatcgttccaaaattcttttggtagggacttgaatgac
gcttacgaatggctgatgaattacaaaaaatctaaagatgttagtaatttaaaccaagcg
tgggacatttactataatgttttcaggaaaattggtaaacagttgccacaattacaaact
cttgaactacaacatgtgtcgccaaaactactatctgcgcatgatttggaattggctgtc
cccgggacccgtgcaagtggtggaaaaccaattgttaaaatatctaaattcgagccagta
ttttcagtaatctcatccaaacaaagaccgagaaagttttgtatcaagggtagtgatggt
aaagattataagtatgtgttgaaaggacatgaagacattagacaggatagcttggtcatg
caattattcggactagttaacacgcttttgcaaaatgacgctgagtgctttagaaggcat
ctagatatccagcaatatccagcaatcccattatctccgaagtctgggttactgggttgg
gtaccgaatagtgacacgttccatgtattaattagggagcatagagaagccaaaaaaatt
cctttaaacattgagcattgggtcatgttacaaatggcacctgattatgacaatttaacg
ttgttgcagaaagtagaagtcttcacttacgccctaaataatacggagggacaagatctt
tataaggtgttatggctgaagagtaggtcatcggaaacgtggttggagcgtagaactact
tacactcgatcgctagccgtgatgtccatgaccggttatatattggggttaggtgaccgc
caccctagtaatttgatgttggatagaatcactgggaaagtcattcatattgattttggt
gattgtttcgaggctgctatattaagagaaaaattccccgaaaaagtaccttttagatta
actagaatgttaacatatgcaatggaagtgagtggaattgaaggtagcttccgtattact
tgtgagaatgttatgaaggtacttagagataacaagggttcattaatggcaatccttgaa
gcttttgctttcgatcctttgatcaattggggttttgacttaccaacaaagaaaattgag
gaagaaacgggcattcaacttcccgtgatgaatgccaatgagctattgagtaatggggct
attaccgaagaagaagttcaaagggtggaaaacgagcacaagaatgccattcgaaatgca
agggccatgttggtattgaagcgcattactgacaaattaacggggaacgatataagaagg
tttaatgacttggacgttccagaacaagtggataaactaatccaacaagccacatcagtg
gaaaacctatgccaacattatatcggttggtgtccattctggtag

DBGET integrated database retrieval system