KEGG   Saccharomyces cerevisiae (budding yeast): YKL211CHelp
Entry
YKL211C           CDS       T00005                                 

Gene name
TRP3
Definition
(RefSeq) bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01230  Biosynthesis of amino acids
Module
sce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YKL211C (TRP3)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YKL211C (TRP3)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     YKL211C (TRP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS GATase Peptidase_C26 QRPTase_C His_biosynth
Motif
Other DBs
NCBI-GeneID: 853669
NCBI-ProteinID: NP_012711
SGD: S000001694
UniProt: P00937
Position
XI:complement(36699..38153)
Genome map
AA seq 484 aa AA seqDB search
MSVHAATNPINKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLL
ISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPI
SHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGIIMGVRHKKYTVEGVQF
HPESILTEEGHLMIRNILNVSGGTWEENKSSPSNSILDRIYARRKIDVNEQSKIPGFTFQ
DLQSNYDLGLAPPLQDFYTVLSSSHKRAVVLAEVKRASPSKGPICLKAVAAEQALKYAEA
GASAISVLTEPHWFHGSLQDLVNVRKILDLKFPPKERPCVLRKEFIFSKYQILEARLAGA
DTVLLIVKMLSQPLLKELYSYSKDLNMEPLVEVNSKEELQRALEIGAKVVGVNNRDLHSF
NVDLNTTSNLVESIPKDVLLIALSGITTRDDAEKYKKEGVHGFLVGEALMKSTDVKKFIH
ELCE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcacgctgcaacaaacccaatcaataagcatgtggttctaattgacaactac
gattcctttacctggaacgtttacgagtacttgtgccaggagggcgccaaagtgagcgtc
taccgtaacgatgcaattacagttccagaaattgccgccttgaatcccgacacattgctt
atctcgcctggaccaggccacccaaagacagattctggcatttcaagagactgtatccgg
tactttactgggaaaattcctgtatttggaatctgtatgggccagcaatgcatgtttgac
gtatttggtggtgaagttgcctacgctggtgagattgtccacggtaaaacgtccccaatc
tctcacgacaactgtggaattttcaagaacgtgccgcaaggtattgctgtgacaagatac
cattcattggccgggacagaatcgtccctaccatcctgcttgaaggttactgcgagtacc
gaaaatggaattatcatgggtgtaagacacaagaagtacactgtagaaggtgtgcaattt
catccggaatccatcttgaccgaggaaggtcatctgatgatcaggaacattttaaacgtc
agtggaggcacttgggaggaaaacaaatcatctccttcaaattctattttggaccgtatc
tatgctcggcgtaaaatagacgtcaatgagcagtctaaaatcccaggtttcacctttcaa
gacttacaatctaactatgatttaggtcttgccccaccgttacaggatttctacacggtg
ttgtcatcatcccataaaagagccgttgttcttgctgaagtcaagcgtgcctctccatcg
aagggacccatttgtttaaaagctgttgctgctgaacaggctctcaaatacgcagaggct
ggtgcatccgcaatttccgtattgaccgaacctcattggtttcacggttcgttacaggat
ttagtaaatgtgaggaaaatcctagatttgaaatttcctcccaaggagaggccttgtgtt
ttgagaaaagaatttattttcagcaagtatcaaatactagaagcaagattagctggagct
gacactgtccttcttatagtcaagatgctatctcaacccttattgaaggaactgtacagc
tacagtaaagatttgaacatggaacctctcgttgaggtgaactccaaagaggaattacaa
agggctctagaaattggtgctaaagttgtaggtgtcaataatagggacctgcattcattc
aacgtagacctaaataccaccagtaacttggtagaatctattccaaaggatgttcttcta
attgctctatcgggaattaccaccagggacgatgctgaaaaatacaaaaaagaaggtgtc
catggatttttagtgggtgaagccctaatgaaatcaaccgatgtgaagaagttcattcat
gaattatgcgaataa

DBGET integrated database retrieval system