KEGG   Saccharomyces cerevisiae (budding yeast): YKL211CHelp
Entry
YKL211C           CDS       T00005                                 

Gene name
TRP3
Definition
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase (EC:4.1.1.48 4.1.3.27)
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YKL211C (TRP3)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YKL211C (TRP3)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YKL211C (TRP3)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     YKL211C (TRP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(36699..38153)
Genome map
AA seq 484 aa AA seqDB search
MSVHAATNPINKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLL
ISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPI
SHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGIIMGVRHKKYTVEGVQF
HPESILTEEGHLMIRNILNVSGGTWEENKSSPSNSILDRIYARRKIDVNEQSKIPGFTFQ
DLQSNYDLGLAPPLQDFYTVLSSSHKRAVVLAEVKRASPSKGPICLKAVAAEQALKYAEA
GASAISVLTEPHWFHGSLQDLVNVRKILDLKFPPKERPCVLRKEFIFSKYQILEARLAGA
DTVLLIVKMLSQPLLKELYSYSKDLNMEPLVEVNSKEELQRALEIGAKVVGVNNRDLHSF
NVDLNTTSNLVESIPKDVLLIALSGITTRDDAEKYKKEGVHGFLVGEALMKSTDVKKFIH
ELCE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcacgctgcaacaaacccaatcaataagcatgtggttctaattgacaactac
gattcctttacctggaacgtttacgagtacttgtgccaggagggcgccaaagtgagcgtc
taccgtaacgatgcaattacagttccagaaattgccgccttgaatcccgacacattgctt
atctcgcctggaccaggccacccaaagacagattctggcatttcaagagactgtatccgg
tactttactgggaaaattcctgtatttggaatctgtatgggccagcaatgcatgtttgac
gtatttggtggtgaagttgcctacgctggtgagattgtccacggtaaaacgtccccaatc
tctcacgacaactgtggaattttcaagaacgtgccgcaaggtattgctgtgacaagatac
cattcattggccgggacagaatcgtccctaccatcctgcttgaaggttactgcgagtacc
gaaaatggaattatcatgggtgtaagacacaagaagtacactgtagaaggtgtgcaattt
catccggaatccatcttgaccgaggaaggtcatctgatgatcaggaacattttaaacgtc
agtggaggcacttgggaggaaaacaaatcatctccttcaaattctattttggaccgtatc
tatgctcggcgtaaaatagacgtcaatgagcagtctaaaatcccaggtttcacctttcaa
gacttacaatctaactatgatttaggtcttgccccaccgttacaggatttctacacggtg
ttgtcatcatcccataaaagagccgttgttcttgctgaagtcaagcgtgcctctccatcg
aagggacccatttgtttaaaagctgttgctgctgaacaggctctcaaatacgcagaggct
ggtgcatccgcaatttccgtattgaccgaacctcattggtttcacggttcgttacaggat
ttagtaaatgtgaggaaaatcctagatttgaaatttcctcccaaggagaggccttgtgtt
ttgagaaaagaatttattttcagcaagtatcaaatactagaagcaagattagctggagct
gacactgtccttcttatagtcaagatgctatctcaacccttattgaaggaactgtacagc
tacagtaaagatttgaacatggaacctctcgttgaggtgaactccaaagaggaattacaa
agggctctagaaattggtgctaaagttgtaggtgtcaataatagggacctgcattcattc
aacgtagacctaaataccaccagtaacttggtagaatctattccaaaggatgttcttcta
attgctctatcgggaattaccaccagggacgatgctgaaaaatacaaaaaagaaggtgtc
catggatttttagtgggtgaagccctaatgaaatcaaccgatgtgaagaagttcattcat
gaattatgcgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system