KEGG   Saccharomyces cerevisiae (budding yeast): YKR056WHelp
Entry
YKR056W           CDS       T00005                                 

Gene name
TRM2, NUC2, NUD1, RNC1
Definition
Trm2p (EC:2.1.1.35)
Orthology
K15331  
tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.35  tRNA (uracil54-C5)-methyltransferase
     YKR056W (TRM2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    YKR056W (TRM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:549448..551367
Genome map
AA seq 639 aa AA seqDB search
MYEQFEFSFFFFENSDNKVKYKAHLISSIKRWSIITCMRCFWTVQKSIFKARFFACRNFV
KKHNYKLISTMTGSTEMVPPTMKHTVDNKRLSSPLTDSGNRRTKKPKLRKYKAKKVETTS
PMGVLEFEVNDLLKSQNLSREQVLNDVTSILNDKSSTDGPIVLQYHREVKNVKVLEITSN
GNGLALIDNPVETEKKQVVIIPFGLPGDVVNIKVFKTHPYYVESDLLDVVEKSPMRRDDL
IRDKYFGKSSGSQLEFLTYDDQLELKRKTIMNAYKFFAPRLVAEKLLPPFDTTVASPLQF
GYRTKITPHFDMPKRKQKELSVRPPLGFGQKGRPQWRKDTLDIGGHGSILDIDECVLATE
VLNKGLTNERRKFEQEFKNYKKGATILLRENTTILDPSKPTLEQLTEEASRDENGDISYV
EVEDKKNNVRLAKTCVTNPRQIVTEYVDGYTFNFSAGEFFQNNNSILPIVTKYVRDNLQA
PAKGDDNKTKFLVDAYCGSGLFSICSSKGVDKVIGVEISADSVSFAEKNAKANGVENCRF
IVGKAEKLFESIDTPSENTSVILDPPRKGCDELFLKQLAAYNPAKIIYISCNVHSQARDV
EYFLKETENGSAHQIESIRGFDFFPQTHHVESVCIMKRI
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaacagtttgaattttctttttttttcttcgaaaattcagacaataaggttaaa
tataaagctcatctcatctcatcgataaaacgctggagtattatcacatgcatgcgttgc
ttttggaccgtacagaagtctatatttaaagctaggtttttcgcttgcagaaactttgtc
aagaagcataattataaactaatcagcaccatgactggaagtactgaaatggtaccacca
acaatgaaacataccgttgacaacaaaaggctttcgtctcctttgacagattctggtaac
cgccggactaagaagccaaagttgagaaagtacaaggccaaaaaggttgaaacaacttct
ccgatgggtgtcctagaatttgaagtgaacgatttgttaaaatctcaaaatttgtccagg
gagcaggttctgaacgatgttacttcaattctaaatgataagtcctcaacagatggacct
atcgtcttacaatatcaccgagaggtaaaaaatgtcaaggtcttagaaattacttccaat
ggcaacgggttggctttgatcgataatcctgttgaaacagaaaagaagcaagttgttatc
ataccgtttggcctgcccggtgatgtagttaatatcaaagtctttaagacccacccttac
tatgtcgagagtgatttattagacgtagtggaaaaatctccaatgagaagagatgattta
attagggataaatatttcgggaaatcttcaggaagtcaattagagttcttaacttacgat
gaccaactagaattgaaaagaaaaacaattatgaatgcctacaagttcttcgcaccaagg
ttagttgctgaaaaacttttacccccatttgacaccaccgtagcttcccctttacaattt
ggctacaggaccaaaattacgcctcatttcgatatgccaaaaagaaaacaaaaggaacta
tcagtaaggcctcctttaggatttggtcaaaagggtagacctcaatggagaaaagatact
ttggatatcggcggacatggttcgatattagatatcgatgaatgtgtgcttgcaactgaa
gttctcaacaaaggattgactaatgaaagaagaaagtttgagcaagagtttaaaaactac
aaaaaaggcgcgactattttactgagagagaataccactattttagacccttccaaacca
actttagaacagttaaccgaagaagcctctagggatgaaaatggtgatataagttatgtc
gaagtcgaagacaaaaagaacaatgtcaggctggctaaaacttgcgttaccaatcctaga
caaattgtcactgaatatgttgatggatatacttttaattttagtgcgggtgagtttttt
caaaataataactctatcctgccaatagtgaccaagtatgtccgtgataacttgcaagct
cccgctaaaggtgatgataataaaacaaagtttctagtagatgcttattgtggatcaggt
cttttcagtatatgcagctccaagggcgtagataaagtgattggtgtagaaatttccgct
gacagtgtctcttttgcagaaaaaaatgcaaaggcaaatggtgttgaaaactgtagattc
atcgttggaaaggctgagaaactctttgagtctattgatactccaagtgaaaacacttcc
gttatcttggatccaccacgcaagggctgtgacgaattattcctaaagcaattagccgca
tataatccagccaagattatttacatatcgtgtaatgtccattcccaggcacgtgatgtc
gagtacttcctcaaagaaacagaaaacggttccgcccaccagattgaaagcataagagga
tttgatttctttccacaaacgcaccacgttgagagtgtgtgtataatgaagagaatctaa

DBGET integrated database retrieval system