KEGG   Saccharomyces cerevisiae (budding yeast): YKR066CHelp
Entry
YKR066C           CDS       T00005                                 

Gene name
CCP1
Definition
(RefSeq) cytochrome-c peroxidase
  KO
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     YKR066C (CCP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 
3E2O 2EUT 1Z53 4NVB 4JMW 1ZBY 5U5V 5U61 4NVH 2RBT 2Y5A 5U5Z 4JM5 5U5W 1ZBZ 5U5Y 4NVD 4JM8 4JMB 2EUQ 2AS4 5U5U 5UG2 2AQD 4JQK 4JQN 2RBV 2EUR 3M2E 3M2F 3M2G 3M2H 3M2I 3M23 3M25 3M26 3M27 3M28 3M29 3M2A 3M2B 3M2C 3M2D 2EUP 2AS3 4JQM 4JPL 4JPT 4JPU 4JM9 4NVL 4JM6 2EUO 2EUU 2AS2 2AS6 4NVN 2IA8 4NVF 5U60 5EJX 2RBW 2RBX 2RBY 2RC0 2RC2 1JDR 4NVI 4NVM 1S73 4NVE 5U5X 5EJT 4XV6 2EUS 2AS1 4NVK 4XV8 4NVA 1MKR 4NVC 4JQJ 4JMT 4JMA 3EXB 2ICV 4A6Z 4A71 4XV7 1MKQ 5D6M 4XV5 1ML2 1MK8 2XJ5 2XIL 2V2E 4XV4 2XJ8 1SDQ 1SBM 2EUN 2BCN 1KOK 2CYP 4NVO 4A7M 4NVG 1KXM 4JMS 2ANZ 2RBU 2RBZ 2V23 1KXN 1RYC 1CCA 4NVJ 2YCG 4JMV 4JMZ 1STQ 1SOG 4JN0 2X07 1S6V 4OQ7 1BVA 1JCI 4CCX 1CMP 1DJ5 1DJ1 1KRJ 1DSE 1BES 1CCL 1CCC 5CIF 4P4Q 4A78 2X08 1DS4 1DSO 1DSP 5CIG 5CIC 4CVI 1A2F 1A2G 1CCK 1AEJ 1AEK 1AEM 1AEN 1AEO 1AEQ 1AES 1AET 1AEU 1AEV 1AEB 1AED 1AEE 1AEF 1AEG 1AEH 1AC8 1AC4 1AA4 1CCJ 1CMT 1CMU 1CCG 1CCB 4NFG 1BEQ 4CVJ 1EBE 1BJ9 1BEK 1BEM 1BEP 1CPD 1CPE 1CPF 1CPG 1DCC 2CEP 5CCP 6CCP 7CCP 1CCP 2CCP 3CCP 4CCP 2B11 3CCX 1CCE 1CMQ 2PCC 1CYF 4JB4 3R98 3R99 1U74 1BEJ 1CCI 2RC1 1U75 1DSG 5CIE 5CIH 4XVA 2B0Z 5CID 2B10 2PCB 5CIB 2B12 2N18 2JTI 2GB8
Thumbnails

Jmol
Position
XI:complement(566113..567198)
Genome map
AA seq 361 aa AA seqDB search
MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWG
KAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHT
SGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGV
TAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG
AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLP
TDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgttaggcttttaccttcactgggcagaaccgcccataagaggtctctc
tacctgttctccgctgctgctgctgctgctgctgctgcaacttttgcttactcgcaatcc
caaaagagatcatcgtcttctcccgggggtggtagtaaccacggatggaacaactggggg
aaggcagctgctttggcttccactacaccgctcgttcatgtcgcctctgtcgaaaaaggg
aggtcatacgaggacttccaaaaggtgtacaatgcgattgcactcaagctgagggaagat
gacgaatatgacaactatataggctatgggcccgtattagtccgtcttgcttggcacact
tcagggacctgggacaagcacgacaatacaggcgggtcatacggtggtacatacagattc
aaaaaggagtttaacgatccatccaatgcgggcttgcagaatggcttcaagttcctggag
cccattcacaaagagtttccctggatctcctcgggtgatctgttcagtctagggggtgtc
actgccgtgcaggaaatgcagggtcccaagattccatggagatgtggtagagtcgacacg
ccagaggatactacccctgacaacgggagactgcctgacgctgataaagacgctgactat
gtcagaacattttttcaaagacttaatatgaatgacagagaagtagttgctcttatgggg
gctcacgctctgggcaagacccacttgaagaactctggatacgaagggccatggggagcc
gctaacaacgtctttaccaatgagttttacttgaacttgctgaatgaagactggaaattg
gaaaagaacgacgcgaacaacgaacagtgggactctaagagcggctacatgatgctgccc
actgattattctttgattcaggatcccaagtacttaagcattgtgaaagaatacgctaat
gaccaggacaagttcttcaaggatttttccaaagcttttgaaaaactgttggagaacggt
atcactttccctaaagacgcgcccagtccatttattttcaagactttagaggaacaaggt
ttatag

DBGET integrated database retrieval system