KEGG   Saccharomyces cerevisiae (budding yeast): YKR098CHelp
Entry
YKR098C           CDS       T00005                                 

Gene name
UBP11
Definition
Ubp11p (EC:3.4.19.12 3.1.2.15)
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YKR098C (UBP11)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YKR098C (UBP11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XI:complement(633026..635179)
Genome map
AA seq 717 aa AA seqDB search
MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT
AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY
LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI
VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE
VSSQIRDSSQDSSSSLSKVEKPKEEEGKIEAIESSAPKAYNLPVIEDSNDLLSELSITGL
QNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLN
GGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY
DANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSL
AIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKK
KSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHL
SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH
EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMDEENYEEEFC
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaacccagatcaaattctaaacctagttcgaaaagtatatgaagtagatatt
aaacagttttattcgcaattacggctaaagaacttaagaggattgttagaccatgctgct
catctgtttaatgtttacctgagggatttagaaatcaatcaggaaatggaagctttgaca
gcatttattattggttgttattatctgtaccttattattccacaatcgttacaattccaa
acaagaaataatctctacagcagttacgcaaagctaaaaaacgactatcaagacgaacac
gtgatgggttatgtgttaaaagtggtaagagatgaaagtactgttattgttgaccggtat
ttagcggagtcaaacggaatttgcaggaccataaaaagaaaaagagcctactccttaccg
ctacggcctttacctgttcatatggcctctttgtcaatacataacaagtttgatggctca
ctacatgaaataccgaatgagctaacaaaaccaacaaatgataattcgaaagaggacata
gtcagggaaagtaatcagatagcatcaagtaataaattggaagctggttctgaagtggcg
tactacacaagcaaagaagcattatcaaaaccctcgtatttaaaactcagtactggaaag
gatgcattattcaaaacgctgtctagtccagcaactgctccccccgtgcactccttggag
gtttcgtcacaaatcagagattctagccaagattcttcatcctctttatccaaggtggaa
aagccaaaggaggaagaaggaaagatcgaggccatagaatcttcggccccgaaagcttac
aatctaccagtaattgaagattctaatgatctgttatcagagttatctattactggcctg
caaaatccatgcaatacatgctatattaacagtataattcaatgtctgtttggcactacc
ttatttcgggatttgtttttaaccaagaaatataggctattcctcaatactaacaaatat
ccgaaagaagtccaactttcccgctcgatttacgttttgttcaaaaaaatgtatttgaat
ggaggaagagcgattataccaaatagattcttaaaaatgtgcaagaagttaaggccagat
ttgaacatcccagatgatcaacaggatacacaggaatttctactaatagttttagcacga
atacatgaagagctctcgaacgaaaatgttgtcaagtattatccagatctagtgtcatat
gatgcgaatgctttacaagttaacccatccaaatacgagaaatggtacgagagaaatgtt
attactgatggtttatctccaattgatcacatatatcgagggcagttggagaacattttg
aaatgtcagcgctgtggtaattcttcttatagctattctaccttctatgttctgtcactt
gcgattccaaaactatcattgtatagctttacaagtaagtcgagaaaaattaaattagag
gattgcataaacttatttacaggcgatgaagaactgtcaggcgacaatgcttgggattgt
cctaattgtagaattactgattctaaatccaaaaaagaagaaattactagccagaagaaa
aaatcaaccatattcggttttcattccagatcaaggtcaaaatcaccccaccatcatcac
catcatcaccatagcagcgatgattcaacaaaaaatgcaaagaagcgaaattctaaaaag
ttaaccacgattaagagtttagactttatagttttacctccgatacttgtcattcattta
tcaaggttctattatgatttaacaaaaaaaaacagcactgtaataacctaccctttgata
ttgaacattattttaaagaacggtaaagtgattcgatacaagttatatggaacggtgaat
cattccggtaaccttatcaatggacactatacttctgttgtgaacaaagaaaagagccat
gaaattggactgaatagacaagtttgggttacatttgatgacgattatatacagcaacat
cgcaaggatcgcaacaactttgaagccggcaaaacagaaatgtctagcgatgaggtatac
gtcttattctacgaaagaatggatgaagagaactatgaagaagaattctgttaa

DBGET integrated database retrieval system