KEGG   Saccharomyces cerevisiae (budding yeast): YLL004WHelp
Entry
YLL004W           CDS       T00005                                 

Gene name
ORC3
Definition
origin recognition complex subunit 3
Orthology
K02605  
origin recognition complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLL004W (ORC3)
   04113 Meiosis - yeast
    YLL004W (ORC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:141073..142923
Genome map
AA seq 616 aa AA seqDB search
MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWEL
YHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKD
ESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNND
VSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVE
FILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTF
MFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNIT
NFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDF
YIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQ
STKSYDLVEKCVWRGI
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttaaccaatccaaaaagatgaacgtcagcgagtttgctgacgcccaaagg
agccactatacagtataccccagtttgcctcaaagtaacaaaaatgataaacacattccc
tttgtcaaacttctatcaggcaaagaatcggaagtgaacgtggaaaaaagatgggaattg
tatcatcagttacattcccactttcatgatcaagtagatcatattatcgataatattgaa
gcagacttgaaagcagagatttcagaccttttatatagtgaaactactcagaaaaggcga
tgctttaacactattttcctattaggttcagatagtacgacaaaaattgaacttaaagac
gaatcttctcgctacaacgttttgattgaattgactccgaaagaatctccgaatgtaaga
atgatgcttcgtaggtctatgtacaaactttacagcgcagctgatgcagaagaacatcca
actatcaagtatgaagacattaacgatgaagatggcgattttaccgagcaaaacaatgat
gtatcatacgatctgtcacttgtggaaaacttcaaaaggctttttggaaaagacttagca
atggtatttaattttaaagatgtagattctattaacttcaacacattggataacttcata
attctattgaaaagtgccttcaagtatgaccatgttaaaataagtttaatctttaatatt
aatacaaacttgtcaaatattgagaaaaatttgagacaatcaaccatacgacttctgaag
agaaattatcataaactagacgtgtcgagtaataaaggatttaagtacggaaaccaaatc
tttcaaagctttttggatacggttgatggcaaactaaatctttcagatcgttttgtggaa
ttcattctcagcaagatggcaaataatactaatcacaacttacaattattgacgaagatg
ctggattattcgttgatgtcgtactttttccagaatgccttttcagtattcattgaccct
gtaaatgttgattttttgaacgacgactacttaaaaatactgagcagatgtcctacattc
atgttctttgtcgaaggtcttataaagcagcatgctcctgctgacgaaattctttcatta
ttgacaaacaaaaacagaggcctagaagagttttttgttgagtttttggtaagagagaac
ccgattaacgggcatgctaagtttgttgctcgattcctcgaagaagaattgaatataacc
aattttaatctgatagaattatatcataatttgcttattggcaaactagactcctatcta
gatcgttggtcagcatgtaaagagtataaggatcggcttcattttgaacccattgataca
atttttcaagagctatttactttggacaacagaagtggattacttacccagtcgattttc
ccttcttacaagtcaaatatcgaagataacttactaagttgggagcaggtgctgccttcg
cttgataaagaaaattatgatactctttctggagatttggataaaataatggctccggta
ctgggtcagctattcaagctttatcgtgaggcgaatatgactatcaacatttacgatttc
tacattgcgttcagagaaacattaccaaaagaggaaatattaaatttcataagaaaagat
ccctccaacaccaaactcttagaactagcagaaacaccggacgcatttgacaaagtagca
ctaattttattcatgcaagcaatcttcgcctttgaaaacatgggtctcattaagtttcaa
agcaccaagagttacgatctggtagaaaaatgtgtctggagaggaatttag

DBGET integrated database retrieval system