KEGG   Saccharomyces cerevisiae (budding yeast): YLL019CHelp
Entry
YLL019C           CDS       T00005                                 

Gene name
KNS1
Definition
Kns1p (EC:2.7.12.1)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YLL019C (KNS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(105686..107899)
Genome map
AA seq 737 aa AA seqDB search
MSQNIQIGTRKRSRANMNNSTTTGPANNTSSNKTFLDNFEETRTNKLLDEMFARQNSFLT
DNLRNSLDLNQADNPLRPRQHQHQLFLDNENAIELDEEPRIINTTINNSNNHNSSRVDED
ADDDIIFIKEQPIQFSSPLILPSSSSINNNNNIVTSNNPGCGTAATSNSTYITTPKKFKK
QRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVTQTENELLHLTGSCAKTLEGNKAVNL
TIAHSTSPFSNPPAQIASLPQSNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYV
YQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELR
ILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAI
ARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKI
LKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIG
ESLYPIHENLEHMAMMQRINGTPFPTDIIDKMFYKSKHKLGNSPSDLNSTVIKHFDRKTL
SLQWPEKNKRGDTITTEKSMKRVLQSCDRLDIYISKVLKQDYGDSLSINWNLPPEKNWSL
INSKLAWKRQTHSSSSSTTDELDKETFLFWYWFIDLLRKMFEFDPTKRITAKDALDHEWF
NLGILDDGIATYNNTQG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagaatattcaaattggcactagaaaacgttcaagagcaaatatgaataattcc
actactacgggccctgctaacaatacaagctctaacaagacctttttggataatttcgaa
gaaacgcgcacaaacaagctgctggacgagatgtttgctcggcaaaattcttttctaaca
gacaatctgaggaacagtctagacctgaatcaagcagacaatccgctccgtcctcggcaa
caccaacaccagttgttcttggacaatgaaaatgccatagaactagacgaggagccgcgt
atcattaacaccacaatcaataacagtaataatcataacagtagtcgagtggacgaggat
gctgacgatgacatcatttttatcaaagagcagccaattcagttttcgtcacctttgatt
ctgcctagtagcagcagtatcaataacaacaataatattgttacttcaaataatccaggg
tgcggtaccgcagctacaagcaatagtacgtatatcacgacaccaaagaaattcaagaag
caaagaaccatctcactgcctcagttgcctctatcgaagctgagctaccaatcgaactat
tttaatgttcctgatcaaaccaacgctatcgtgccaagagtaacgcaaactgaaaatgag
ctgttgcatctaacggggtcgtgtgcaaagactctggagggcaacaaggcagtgaatctc
acgattgctcacagcacttctcccttttccaacccaccagcacaaatagcttccctgcct
caatccaacctcaagaaacaaattggttcttcactacggaaatttacatcaaacggctct
tcagaaagcgcatcatccaataaatcaaatttcaaaacggacaaagacggtcactacgtt
taccaggaaaacgacatatttggcagtggcggccgctttgttgtgaaggacctattgggc
caaggcacgtttggtaaagtacttaaatgcatcgataacaagtatgaacctaattacgtg
gctgtaaaagtgataagggctgtagatagatatagagaagccgccaaaacagaactaaga
attctacagactatcctgaataatgaccctcaaggtcagttccagtgcctcttgctaagg
gagtgcttcgattacaaaaatcacatttgtttggtgacagatctatacggcaggtccatt
tacgattttatgtgctccaacggcattgccaggttccccggctctcatattcaggccatt
gccagacagctaatcagatctgtctgcttcttgcacgatttgggcataatacacacggat
ttgaaaccagaaaatatcctgatttgtgacgaaacccatattgctcaaaaattgcctttg
aaaaccgtacagtcgctaagcaagagacgccgtgaagccagtaaggggaagcgcaaaatc
ttgaaaaatccagaaatcaaaatcattgatttcggtagcgcaattttccattacgaatat
catcctcctgtaatatccactcgtcactatagagccccggaaattgtccttggcttgggc
tggtcgttcccctgcgacatttggtccatcgcgtgtgtcctagtagaactggttattggc
gaatctctttaccccattcatgaaaatctagaacatatggctatgatgcaacgaatcaat
ggaacccctttccccacagacattattgataagatgttttacaaatctaaacataaattg
ggcaactctccatcagacctaaattcaacggtgataaagcatttcgacagaaaaacttta
agcttacaatggcctgaaaaaaataaacgcggagataccataaccaccgaaaagtcaatg
aaaagggtcttgcagtcatgtgatcgcttagatatttacatctcaaaggtcttgaaacag
gattacggcgatagcttaagcatcaattggaatctaccgccggagaaaaactggtctttg
ataaattcgaaattggcatggaaaagacaaacacattcctcttcttcctcaactactgat
gaactcgataaggaaactttcttgttttggtactggttcatcgatctactcaggaaaatg
tttgagttcgacccaacaaaaaggattaccgcaaaggacgctctggaccatgaatggttt
aatctgggcatactggatgatggtattgcaacttataataatacccaaggatag

  All links  
No link information was found.   
DBGET integrated database retrieval system