KEGG   Saccharomyces cerevisiae (budding yeast): YLL026WHelp
Entry
YLL026W           CDS       T00005                                 

Gene name
HSP104
Definition
(RefSeq) chaperone ATPase HSP104
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YLL026W (HSP104)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP100
   YLL026W (HSP104)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA ClpB_D2-small Clp_N AAA_5 Sigma54_activat AAA_16 AAA_22 TIP49 AAA_24 AAA_33 Zeta_toxin AAA_3 Torsin IstB_IS21 AAA_19 PEPCK_ATP IncA
Motif
Other DBs
NCBI-GeneID: 850633
NCBI-ProteinID: NP_013074
SGD: S000003949
UniProt: P31539
Structure
PDB: 

Jmol
Position
XII:88623..91349
Genome map
AA seq 908 aa AA seqDB search
MNDQTQFTERALTILTLAQKLASDHQHPQLQPIHILAAFIETPEDGSVPYLQNLIEKGRY
DYDLFKKVVNRNLVRIPQQQPAPAEITPSYALGKVLQDAAKIQKQQKDSFIAQDHILFAL
FNDSSIQQIFKEAQVDIEAIKQQALELRGNTRIDSRGADTNTPLEYLSKYAIDMTEQARQ
GKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAIIEGVAQRIIDDDVPTILQG
AKLFSLDLAALTAGAKYKGDFEERFKGVLKEIEESKTLIVLFIDEIHMLMGNGKDDAANI
LKPALSRGQLKVIGATTNNEYRSIVEKDGAFERRFQKIEVAEPSVRQTVAILRGLQPKYE
IHHGVRILDSALVTAAQLAKRYLPYRRLPDSALDLVDISCAGVAVARDSKPEELDSKERQ
LQLIQVEIKALERDEDADSTTKDRLKLARQKEASLQEELEPLRQRYNEEKHGHEELTQAK
KKLDELENKALDAERRYDTATAADLRYFAIPDIKKQIEKLEDQVAEEERRAGANSMIQNV
VDSDTISETAARLTGIPVKKLSESENEKLIHMERDLSSEVVGQMDAIKAVSNAVRLSRSG
LANPRQPASFLFLGLSGSGKTELAKKVAGFLFNDEDMMIRVDCSELSEKYAVSKLLGTTA
GYVGYDEGGFLTNQLQYKPYSVLLFDEVEKAHPDVLTVMLQMLDDGRITSGQGKTIDCSN
CIVIMTSNLGAEFINSQQGSKIQESTKNLVMGAVRQHFRPEFLNRISSIVIFNKLSRKAI
HKIVDIRLKEIEERFEQNDKHYKLNLTQEAKDFLAKYGYSDDMGARPLNRLIQNEILNKL
ALRILKNEIKDKETVNVVLKKGKSRDENVPEEAEECLEVLPNHEATIGADTLGDDDNEDS
MEIDDDLD
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaaacgcaatttacagaaagggctctaacgattttgacgttggctcaaaaa
ttggcttcggatcatcaacatccacaattacaacctatacatattctagctgccttcatt
gaaacgccagaagatggatcagtcccttacctacagaatctaattgagaagggccgttac
gactatgatcttttcaagaaagtggttaatagaaatctagtaagaattcctcaacagcaa
cctgcacctgcggagataactccaagttatgctttggggaaagtccttcaagacgctgct
aagattcaaaaacaacagaaggactcatttatagcgcaagaccatatattgtttgctcta
ttcaatgattcgtctattcagcaaatatttaaggaagctcaagtagatattgaggccatc
aagcaacaagctcttgaacttcgtggtaacactagaattgactctcgtggcgctgatacg
aacacacctttggaatatttatcaaagtacgccattgatatgactgagcaggctcgtcaa
ggtaaacttgaccctgtcatcggccgtgaagaagaaataagaagcactattagagtttta
gcaagaagaattaagtccaacccatgtttaattggtgagccaggtatcggtaagaccgct
attattgaaggtgttgctcaaagaatcattgacgatgacgttcccactatcttacaaggc
gctaaattgttcagtctagatttggccgcattaaccgcaggtgctaaatacaaaggtgat
ttcgaagaaagattcaaaggtgttttgaaggaaatcgaagaatcaaagactctaattgtg
ttattcattgatgaaattcacatgttaatgggtaatggtaaggacgacgctgctaacatc
ttgaagccagctttgtccagaggccaattgaaggtcatcggtgccaccaccaataacgaa
tatagatctattgtggaaaaggatggtgcctttgaaagaagattccagaaaattgaagtc
gctgaaccaagtgtgagacaaacagtggccatattgagaggtctgcaaccaaagtatgaa
atacatcatggtgtaaggattctggatagcgccttagtcactgctgctcaattagccaag
cgttacttgccatatagaagattgccagattctgctttggatttagttgatatttcttgt
gctggtgtcgccgtcgcaagagattctaagccagaagaattggattccaaggaacgtcaa
ttgcaattgattcaagtagagataaaagctctagagagagatgaagatgccgactccacc
actaaagatagattaaagttagctaggcagaaggaagcttcattgcaagaagaattggaa
cctctaagacaacgttacaatgaagaaaagcatggccatgaagaattgacacaagctaaa
aagaaattggatgaactggaaaacaaggcccttgatgctgaacgtagatatgatactgct
accgccgctgatttaaggtacttcgccatcccagatatcaaaaagcaaatcgaaaagctt
gaagatcaggttgctgaggaagagagacgtgctggtgccaactccatgatccaaaatgtg
gtcgattcagacaccatttctgaaacagctgcaagattgactggtatccctgttaagaag
ttgtcagaatctgaaaatgaaaaattgattcatatggaacgtgacttatcatctgaagtc
gtgggccaaatggatgccattaaagctgtttccaatgccgttagattgtctagatcaggt
ttagctaatccaaggcaaccagcatccttcttatttttaggtttgtccggttccggtaaa
actgaattggctaaaaaagttgctggatttttgtttaatgatgaggacatgatgatcagg
gtcgattgttctgaattaagcgagaagtatgcggtctctaagttgttgggtaccacggca
ggttatgtcgggtacgatgaaggtggctttttaactaaccaactgcaatacaaaccatac
tccgttttgttattcgatgaagtagaaaaggcacatcctgatgttttgactgtcatgcta
caaatgttggatgacggtagaattacttctggtcaaggtaagacgatcgactgttccaat
tgtattgtcatcatgacttccaatctaggtgctgaatttatcaattctcaacaaggatca
aagatccaagaatctaccaagaatttggtcatgggtgctgttaggcaacatttcagacca
gaatttttgaacagaatttctagtatagtcattttcaacaagctatctagaaaagctatt
cataagatcgtggatattcgtttgaaggaaattgaagagagattcgagcaaaatgataaa
cattacaagttgaatttaactcaagaggccaaggacttcttggccaaatatggttattcc
gatgatatgggtgcacgtccactgaacaggttaattcaaaacgaaattttgaacaaactg
gcactaaggatcttaaagaatgaaatcaaggataaggaaactgtcaatgtcgtcttgaag
aagggtaaatctcgtgatgaaaatgttcctgaggaagctgaagaatgtctggaagttcta
ccaaatcacgaagctactataggggctgacacgttaggtgatgacgataatgaggacagt
atggaaattgatgatgacctagattaa

DBGET integrated database retrieval system