KEGG   Saccharomyces cerevisiae (budding yeast): YLL026WHelp
Entry
YLL026W           CDS       T00005                                 

Gene name
HSP104
Definition
chaperone ATPase HSP104
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:88623..91349
Genome map
AA seq 908 aa AA seqDB search
MNDQTQFTERALTILTLAQKLASDHQHPQLQPIHILAAFIETPEDGSVPYLQNLIEKGRY
DYDLFKKVVNRNLVRIPQQQPAPAEITPSYALGKVLQDAAKIQKQQKDSFIAQDHILFAL
FNDSSIQQIFKEAQVDIEAIKQQALELRGNTRIDSRGADTNTPLEYLSKYAIDMTEQARQ
GKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAIIEGVAQRIIDDDVPTILQG
AKLFSLDLAALTAGAKYKGDFEERFKGVLKEIEESKTLIVLFIDEIHMLMGNGKDDAANI
LKPALSRGQLKVIGATTNNEYRSIVEKDGAFERRFQKIEVAEPSVRQTVAILRGLQPKYE
IHHGVRILDSALVTAAQLAKRYLPYRRLPDSALDLVDISCAGVAVARDSKPEELDSKERQ
LQLIQVEIKALERDEDADSTTKDRLKLARQKEASLQEELEPLRQRYNEEKHGHEELTQAK
KKLDELENKALDAERRYDTATAADLRYFAIPDIKKQIEKLEDQVAEEERRAGANSMIQNV
VDSDTISETAARLTGIPVKKLSESENEKLIHMERDLSSEVVGQMDAIKAVSNAVRLSRSG
LANPRQPASFLFLGLSGSGKTELAKKVAGFLFNDEDMMIRVDCSELSEKYAVSKLLGTTA
GYVGYDEGGFLTNQLQYKPYSVLLFDEVEKAHPDVLTVMLQMLDDGRITSGQGKTIDCSN
CIVIMTSNLGAEFINSQQGSKIQESTKNLVMGAVRQHFRPEFLNRISSIVIFNKLSRKAI
HKIVDIRLKEIEERFEQNDKHYKLNLTQEAKDFLAKYGYSDDMGARPLNRLIQNEILNKL
ALRILKNEIKDKETVNVVLKKGKSRDENVPEEAEECLEVLPNHEATIGADTLGDDDNEDS
MEIDDDLD
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaaacgcaatttacagaaagggctctaacgattttgacgttggctcaaaaa
ttggcttcggatcatcaacatccacaattacaacctatacatattctagctgccttcatt
gaaacgccagaagatggatcagtcccttacctacagaatctaattgagaagggccgttac
gactatgatcttttcaagaaagtggttaatagaaatctagtaagaattcctcaacagcaa
cctgcacctgcggagataactccaagttatgctttggggaaagtccttcaagacgctgct
aagattcaaaaacaacagaaggactcatttatagcgcaagaccatatattgtttgctcta
ttcaatgattcgtctattcagcaaatatttaaggaagctcaagtagatattgaggccatc
aagcaacaagctcttgaacttcgtggtaacactagaattgactctcgtggcgctgatacg
aacacacctttggaatatttatcaaagtacgccattgatatgactgagcaggctcgtcaa
ggtaaacttgaccctgtcatcggccgtgaagaagaaataagaagcactattagagtttta
gcaagaagaattaagtccaacccatgtttaattggtgagccaggtatcggtaagaccgct
attattgaaggtgttgctcaaagaatcattgacgatgacgttcccactatcttacaaggc
gctaaattgttcagtctagatttggccgcattaaccgcaggtgctaaatacaaaggtgat
ttcgaagaaagattcaaaggtgttttgaaggaaatcgaagaatcaaagactctaattgtg
ttattcattgatgaaattcacatgttaatgggtaatggtaaggacgacgctgctaacatc
ttgaagccagctttgtccagaggccaattgaaggtcatcggtgccaccaccaataacgaa
tatagatctattgtggaaaaggatggtgcctttgaaagaagattccagaaaattgaagtc
gctgaaccaagtgtgagacaaacagtggccatattgagaggtctgcaaccaaagtatgaa
atacatcatggtgtaaggattctggatagcgccttagtcactgctgctcaattagccaag
cgttacttgccatatagaagattgccagattctgctttggatttagttgatatttcttgt
gctggtgtcgccgtcgcaagagattctaagccagaagaattggattccaaggaacgtcaa
ttgcaattgattcaagtagagataaaagctctagagagagatgaagatgccgactccacc
actaaagatagattaaagttagctaggcagaaggaagcttcattgcaagaagaattggaa
cctctaagacaacgttacaatgaagaaaagcatggccatgaagaattgacacaagctaaa
aagaaattggatgaactggaaaacaaggcccttgatgctgaacgtagatatgatactgct
accgccgctgatttaaggtacttcgccatcccagatatcaaaaagcaaatcgaaaagctt
gaagatcaggttgctgaggaagagagacgtgctggtgccaactccatgatccaaaatgtg
gtcgattcagacaccatttctgaaacagctgcaagattgactggtatccctgttaagaag
ttgtcagaatctgaaaatgaaaaattgattcatatggaacgtgacttatcatctgaagtc
gtgggccaaatggatgccattaaagctgtttccaatgccgttagattgtctagatcaggt
ttagctaatccaaggcaaccagcatccttcttatttttaggtttgtccggttccggtaaa
actgaattggctaaaaaagttgctggatttttgtttaatgatgaggacatgatgatcagg
gtcgattgttctgaattaagcgagaagtatgcggtctctaagttgttgggtaccacggca
ggttatgtcgggtacgatgaaggtggctttttaactaaccaactgcaatacaaaccatac
tccgttttgttattcgatgaagtagaaaaggcacatcctgatgttttgactgtcatgcta
caaatgttggatgacggtagaattacttctggtcaaggtaagacgatcgactgttccaat
tgtattgtcatcatgacttccaatctaggtgctgaatttatcaattctcaacaaggatca
aagatccaagaatctaccaagaatttggtcatgggtgctgttaggcaacatttcagacca
gaatttttgaacagaatttctagtatagtcattttcaacaagctatctagaaaagctatt
cataagatcgtggatattcgtttgaaggaaattgaagagagattcgagcaaaatgataaa
cattacaagttgaatttaactcaagaggccaaggacttcttggccaaatatggttattcc
gatgatatgggtgcacgtccactgaacaggttaattcaaaacgaaattttgaacaaactg
gcactaaggatcttaaagaatgaaatcaaggataaggaaactgtcaatgtcgtcttgaag
aagggtaaatctcgtgatgaaaatgttcctgaggaagctgaagaatgtctggaagttcta
ccaaatcacgaagctactataggggctgacacgttaggtgatgacgataatgaggacagt
atggaaattgatgatgacctagattaa

DBGET integrated database retrieval system