KEGG   Saccharomyces cerevisiae (budding yeast): YLL036CHelp
Entry
YLL036C           CDS       T00005                                 

Gene name
PRP19, PSO4
Definition
E3 ubiquitin-protein ligase PRP19
Orthology
K10599  
pre-mRNA-processing factor 19 [EC:6.3.2.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Spliceosome
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    YLL036C (PRP19)
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLL036C (PRP19)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     YLL036C (PRP19)
Spliceosome [BR:sce03041]
 Complex B
  Other components
   Prp19 complex
    YLL036C (PRP19)
 Complex C
   Prp19-CDC5 complex
    YLL036C (PRP19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:complement(66745..68256)
Genome map
AA seq 503 aa AA seqDB search
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQA
SLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAK
LVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNL
ELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPR
TGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTE
YFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLS
SPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFK
TGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVV
CGDGGIAAILKTNDSFNIVALTP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtgctattagtgggaaagttcctagaaggccagttctatcacctaaatccagg
actatttttgaaaagtcgctccttgaacagtatgttaaagatacggggaatgatccgata
acaaatgagcccttaagcatcgaagaaatagtggaaatcgtacctagtgcgcaacaagcc
tcactaacagagtctacaaactctgctacgttaaaagcgaattattcgattccgaatctg
ttgacaagtttacagaatgaatgggatgctataatgctcgaaaactttaagttacgatca
actctagatagtttaacgaaaaaactgtcgactgtaatgtacgaaagagatgctgcaaag
ttggtcgctgcgcaactattgatggaaaaaaacgaagattcgaaggatttacccaaatcc
tcacagcaagcggtagctattacgagagaagaatttttacaagggctgttacaatcttct
agagactttgtagcgaggggcaagctcaaagcacccaaatggccgattttaaaaaatttg
gagctattacaggcacaaaattactcccgtaacatcaaaacattcccatataaagagctt
aacaaatctatgtactatgataaatgggtgtgcatgtgtcgctgtgaggatggtgcttta
cattttacccaattaaaagattcgaaaacgattaccacaataactacaccaaatccccgt
accgggggagagcatccagctattatttccagagggccttgtaatcgtttgctactacta
tatccaggtaaccaaataactatattggactcaaaaacaaacaaagtcctcagagaaata
gaggtagattccgccaatgagattatatatatgtatggtcacaacgaggtcaacacagag
tacttcatctgggcggataatagaggaaccataggatttcaatcctacgaggatgattcc
cagtatattgttcattctgctaaatcagatgttgagtacagcagcggtgtcctacataag
gattcattattattagccctttactctccggacggtatattagacgtttacaacttgtca
tcacctgaccaggcaagctctagattccccgtagatgaagaagccaagataaaagaggtt
aaatttgcagacaatgggtactggatggtagtagagtgtgaccaaactgtggtttgcttt
gacctaagaaaggatgtcggcacgctagcgtatccaacttacacaatcccagaattcaag
acgggcaccgttacctatgacattgacgactctggaaagaatatgattgcatactcaaac
gagagcaattcgctgacgatatacaaatttgacaagaaaacaaaaaattggactaaagac
gaggagagcgccctctgtttgcaaagcgacactgccgatttcactgatatggacgtggta
tgcggagatggtggtattgccgctattctgaagacaaatgatagtttcaatattgttgca
ttgacaccctaa

DBGET integrated database retrieval system