KEGG   Saccharomyces cerevisiae (budding yeast): YLL036CHelp
Entry
YLL036C           CDS       T00005                                 

Gene name
PRP19, PSO4
Definition
E3 ubiquitin-protein ligase PRP19
Orthology
K10599  
pre-mRNA-processing factor 19 [EC:6.3.2.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Spliceosome
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:sce03040]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sce04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:complement(66745..68256)
Genome map
AA seq 503 aa AA seqDB search
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQA
SLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAK
LVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNL
ELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPR
TGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTE
YFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLS
SPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFK
TGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVV
CGDGGIAAILKTNDSFNIVALTP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtgctattagtgggaaagttcctagaaggccagttctatcacctaaatccagg
actatttttgaaaagtcgctccttgaacagtatgttaaagatacggggaatgatccgata
acaaatgagcccttaagcatcgaagaaatagtggaaatcgtacctagtgcgcaacaagcc
tcactaacagagtctacaaactctgctacgttaaaagcgaattattcgattccgaatctg
ttgacaagtttacagaatgaatgggatgctataatgctcgaaaactttaagttacgatca
actctagatagtttaacgaaaaaactgtcgactgtaatgtacgaaagagatgctgcaaag
ttggtcgctgcgcaactattgatggaaaaaaacgaagattcgaaggatttacccaaatcc
tcacagcaagcggtagctattacgagagaagaatttttacaagggctgttacaatcttct
agagactttgtagcgaggggcaagctcaaagcacccaaatggccgattttaaaaaatttg
gagctattacaggcacaaaattactcccgtaacatcaaaacattcccatataaagagctt
aacaaatctatgtactatgataaatgggtgtgcatgtgtcgctgtgaggatggtgcttta
cattttacccaattaaaagattcgaaaacgattaccacaataactacaccaaatccccgt
accgggggagagcatccagctattatttccagagggccttgtaatcgtttgctactacta
tatccaggtaaccaaataactatattggactcaaaaacaaacaaagtcctcagagaaata
gaggtagattccgccaatgagattatatatatgtatggtcacaacgaggtcaacacagag
tacttcatctgggcggataatagaggaaccataggatttcaatcctacgaggatgattcc
cagtatattgttcattctgctaaatcagatgttgagtacagcagcggtgtcctacataag
gattcattattattagccctttactctccggacggtatattagacgtttacaacttgtca
tcacctgaccaggcaagctctagattccccgtagatgaagaagccaagataaaagaggtt
aaatttgcagacaatgggtactggatggtagtagagtgtgaccaaactgtggtttgcttt
gacctaagaaaggatgtcggcacgctagcgtatccaacttacacaatcccagaattcaag
acgggcaccgttacctatgacattgacgactctggaaagaatatgattgcatactcaaac
gagagcaattcgctgacgatatacaaatttgacaagaaaacaaaaaattggactaaagac
gaggagagcgccctctgtttgcaaagcgacactgccgatttcactgatatggacgtggta
tgcggagatggtggtattgccgctattctgaagacaaatgatagtttcaatattgttgca
ttgacaccctaa

DBGET integrated database retrieval system