KEGG   Saccharomyces cerevisiae (budding yeast): YLR044CHelp
Entry
YLR044C           CDS       T00005                                 

Gene name
PDC1
Definition
indolepyruvate decarboxylase 1 (EC:4.1.1.74 4.1.1.72 4.1.1.- 4.1.1.1)
Orthology
K01568  
pyruvate decarboxylase [EC:4.1.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:complement(232390..234081)
Genome map
AA seq 563 aa AA seqDB search
MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL
LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS
YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP
ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG
ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI
HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
PVFDAPQNLVEQAKLTAATNAKQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattactttgggtaaatatttgttcgaaagattaaagcaagtcaacgttaac
accgttttcggtttgccaggtgacttcaacttgtccttgttggacaagatctacgaagtt
gaaggtatgagatgggctggtaacgccaacgaattgaacgctgcttacgccgctgatggt
tacgctcgtatcaagggtatgtcttgtatcatcaccaccttcggtgtcggtgaattgtct
gctttgaacggtattgccggttcttacgctgaacacgtcggtgttttgcacgttgttggt
gtcccatccatctctgctcaagctaagcaattgttgttgcaccacaccttgggtaacggt
gacttcactgttttccacagaatgtctgccaacatttctgaaaccactgctatgatcact
gacattgctaccgccccagctgaaattgacagatgtatcagaaccacttacgtcacccaa
agaccagtctacttaggtttgccagctaacttggtcgacttgaacgtcccagctaagttg
ttgcaaactccaattgacatgtctttgaagccaaacgatgctgaatccgaaaaggaagtc
attgacaccatcttggctttggtcaaggatgctaagaacccagttatcttggctgatgct
tgttgttccagacacgacgtcaaggctgaaactaagaagttgattgacttgactcaattc
ccagctttcgtcaccccaatgggtaagggttccattgacgaacaacacccaagatacggt
ggtgtttacgtcggtaccttgtccaagccagaagttaaggaagccgttgaatctgctgac
ttgattttgtctgtcggtgctttgttgtctgatttcaacaccggttctttctcttactct
tacaagaccaagaacattgtcgaattccactccgaccacatgaagatcagaaacgccact
ttcccaggtgtccaaatgaaattcgttttgcaaaagttgttgaccactattgctgacgcc
gctaagggttacaagccagttgctgtcccagctagaactccagctaacgctgctgtccca
gcttctaccccattgaagcaagaatggatgtggaaccaattgggtaacttcttgcaagaa
ggtgatgttgtcattgctgaaaccggtacctccgctttcggtatcaaccaaaccactttc
ccaaacaacacctacggtatctctcaagtcttatggggttccattggtttcaccactggt
gctaccttgggtgctgctttcgctgctgaagaaattgatccaaagaagagagttatctta
ttcattggtgacggttctttgcaattgactgttcaagaaatctccaccatgatcagatgg
ggcttgaagccatacttgttcgtcttgaacaacgatggttacaccattgaaaagttgatt
cacggtccaaaggctcaatacaacgaaattcaaggttgggaccacctatccttgttgcca
actttcggtgctaaggactatgaaacccacagagtcgctaccaccggtgaatgggacaag
ttgacccaagacaagtctttcaacgacaactctaagatcagaatgattgaaatcatgttg
ccagtcttcgatgctccacaaaacttggttgaacaagctaagttgactgctgctaccaac
gctaagcaataa

DBGET integrated database retrieval system