KEGG   Saccharomyces cerevisiae (budding yeast): YLR086WHelp
Entry
YLR086W           CDS       T00005                                 

Gene name
SMC4
Definition
condensin subunit SMC4
Orthology
K06675  
structural maintenance of chromosome 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR086W (SMC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:302243..306499
Genome map
AA seq 1418 aa AA seqDB search
MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT
PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR
RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF
SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI
DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI
LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR
FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD
LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL
VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL
KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI
LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR
SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT
VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY
SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS
DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA
DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK
GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE
RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN
EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED
VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD
VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK
KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatagtccattgagcaaaagacaaaagcggaagtccgcccaagaaccagaatta
tctcttgatcaaggtgatgccgaagaagattcgcaggtagaaaaccgagttaacctaagc
gagaatacaccagagccggatcttcctgcgttggaagcatcttattccaaatcttatact
cccagaaagcttgttttaagttctggggaaaatcggtatgccttttctcaacctacaaac
tcaacaaccacgtcattacatgtaccgaacttgcaaccaccaaaaacctcttctaggggt
cgcgaccataagtcctactctcaatcaccaccaaggtctccaggaagatcgccaactaga
agattagaattgctccagctttcgccagtgaaaaatagcagggttgaactacaaaaaatt
tatgataggcaccagtcgtcgagcaagcaacagagcagactatttattaacgaactagtc
ttagagaacttcaagtcctacgctggtaaacaagtagtaggaccctttcatactagcttc
tcggccgtggtaggccccaatggttcaggtaaatcaaatgtcatcgattccatgttattt
gtatttggatttagagcgaacaagatgagacaggacagattgtcggatttaattcataaa
tcagaagctttcccaagtttgcaatcatgttccgtagctgtacattttcagtacgttatt
gatgaatcttcgggtacttcccgaatcgatgaagaaaaacctggattgatcattacaagg
aaagcctttaaaaacaactcatcgaaatattacataaacgaaaaagaaagtagctacaca
gaggtgacaaagcttttaaagaatgagggtattgatttagaccataaacgatttttaatt
ctacaaggtgaagtagagaatattgctcaaatgaagcctaaagcagaaaaagagagtgac
gacggactactggaatatctggaggacataattggaactgcaaactataagccgttaatt
gaagagcgaatgggacagattgagaatctaaatgaagtttgcctggaaaaggaaaataga
tttgaaattgttgatagagaaaaaaactctttagagtcagggaaagaaacggcgttagag
tttttagagaaggaaaagcagctgacgcttttaagatcaaaattatttcaatttaaattg
ttgcaaagcaactctaaacttgccagcaccttggaaaagatctcctcttcgaataaagac
ctcgaagatgagaagatgaaatttcaagaatctttgaaaaaagtggatgagattaaagca
caacgtaaggaaataaaagatcgaatatcatcttgtagctcgaaagaaaagaccctggtt
ttagaaagaagagaattagaaggcaccagggtgtctctagaagagagaacaaaaaatttg
gtaagtaaaatggaaaaagcagaaaagactttgaaatccaccaaacattcaatatcggag
gccgagaatatgcttgaagagcttcgtggacaacaaaccgaacacgagacggagatcaaa
gacttgactcaattgctggaaaaggaacgaagtatacttgatgatattaaactatctttg
aaagataaaacgaagaatatatctgcagagattattcggcatgaaaaggaactggagcct
tgggacctccaacttcaggaaaaagaatcacagatacaattggctgaatccgaactatct
ttgttggaggaaactcaagctaaactgaaaaaaaacgttgaaactttagaagaaaaaatt
cttgccaagaaaacacacaagcaggagctacaagatcttatcctcgatctgaaaaagaag
ctgaactcacttaaagatgaaaggtcgcaaggtgaaaagaattttacttctgctcatcta
aagttaaaagaaatgcaaaaggttttgaacgcgcatcgccagcgtgcaatggaagctaga
tcctctttatcaaaagctcagaataaaagtaaggttttaacagctttatcgagactgcaa
aagtcaggacgtataaatggtttccatggacgtttgggcgatttgggcgttatcgacgat
agttttgacgttgctatttctactgcttgtccgagactagatgatgtcgtggttgatact
gtagaatgtgcgcaacactgcatcgactacttaagaaaaaacaaacttggttatgcaagg
tttattctcttggataggttacgccaattcaatttacaacctatcagtacaccagaaaat
gtaccgagactatttgatttagttaaacctaaaaacccaaaattctcaaatgcattttac
agtgttcttagagacactttggttgctcagaatttaaaacaagccaataatgtagcatat
gggaagaaaagatttagagttgtcactgtggatgggaaattaattgatatttctggtaca
atgagtggtggtggcaaccatgtagcaaaaggtctaatgaaattaggtacgaatcagtca
gacaaggttgatgattacacccccgaggaagtagataaaattgagcgtgagctatctgaa
agagaaaataacttccgcgtggcaagcgatacggtccacgagatggaggaagaactgaaa
aaattgagggaccacgaaccagacttggaatcacaaatatcaaaggcagaaatggaagct
gattccttggcgagtgaattgacactggcagaacaacaagtgaaagaggcagaaatggcg
tacgtcaaggcagttagtgacaaagcgcaactaaacgtggtgatgaagaatttggaacgc
ttgagaggcgaatacaatgatttgcaatccgaaacaaaaactaaaaaggaaaagatcaaa
ggcttgcaagacgaaatcatgaaaattggtggtatcaaattgcaaatgcaaaattcaaaa
gttgaatcagtttgtcagaaattggatattctagtggccaaacttaaaaaagtcaaatct
gcctcaaagaagtcaggaggagatgtcgtaaagtttcaaaaactgctccaaaactctgaa
agagacgtagaactatcatcagatgagttaaaagtcatcgaagaacaactaaaacataca
aaactggctttggcagaaaatgacacaaatatgaatgagacgctcaacttgaaagttgaa
ttaaaagaacagagcgaacaactgaaggaacaaatggaggacatggaggaaagcatcaat
gaatttaaatctatagaaatcgaaatgaagaacaagctggaaaaattgaactcactgttg
acgtacatcaaaagtgagataacgcagcaagaaaaaggattaaacgaactatcaattagg
gatgtaacccacaccctgggaatgttagacgataataaaatggactcagtgaaagaggat
gttaaaaacaatcaagaacttgatcaggaataccggtcctgtgaaactcaagatgagagt
gaaataaaagacgctgagacttcttgtgacaattatcatcctatgaacattgatgagact
tcagatgaggtatccagagggataccaagactttctgaggacgaattaagggagttggac
gtagaactgattgaaagtaaaataaatgaattgtcatattatgtcgaagagactaacgtg
gatattggagttttggaagagtacgctaggcgcttagcagagttcaaaagaaggaagctg
gatttaaataatgctgttcaaaaaagagatgaagttaaggaacaattaggaatacttaaa
aagaaaagatttgatgaatttatggctggctttaatatcatatcaatgaccctaaaagaa
atgtaccaaatgattactatgggtggaaatgctgaattagaacttgtggatagtctagat
cctttttctgaaggagttacgtttagtgttatgcctcctaaaaagagttggagaaatata
acaaacctttcaggtggtgagaaaacactaagctccttggctttggtttttgctttacat
aagtataaaccaacccccctttatgtcatggatgaaatagatgccgctctggatttcaga
aatgtctcaatcgtagctaactatatcaaagaaagaaccaagaatgcacagtttattgtt
atttcgctgagaaataacatgttcgaattagcacaacagttagttggtgtttataaaaga
gataatagaaccaaaagtaccacgattaaaaacatagatatcttaaacagaacttag

DBGET integrated database retrieval system