KEGG   Saccharomyces cerevisiae (budding yeast): YLR102CHelp
Entry
YLR102C           CDS       T00005                                 

Gene name
APC9
Definition
(RefSeq) anaphase promoting complex subunit 9
  KO
K03356  anaphase-promoting complex subunit 9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Module
sce_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLR102C (APC9)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR102C (APC9)
   04113 Meiosis - yeast
    YLR102C (APC9)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     YLR102C (APC9)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    YLR102C (APC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC9
Motif
Other DBs
NCBI-GeneID: 850792
NCBI-ProteinID: NP_013203
SGD: S000004092
UniProt: Q12107
Position
XII:complement(342970..343767)
Genome map
AA seq 265 aa AA seqDB search
MNQNGDKNEGKLFQLPSLPPWKTPRFNKANFNNFTTPLRKRSTRVINDDSMPITGEVLEE
RTADDLYGINMDVDEVDYLNTLSHIEEEKQYDYSPFCERNTLRESRIDSFLKAERAAHCL
VFHKVGHLDGIDSYRPDIDIMCGEEANKYDSANPEGNGSMLLESVPGCNKEDLERLSRRE
FVTNSKPNMRRLDDIINHETNALKSFWNDSGLVNSLQSHHLHEEYLLLQEELKNVYKIKC
HDRVPIESLRDKCRRHYSNEDSSFL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaatggtgataagaacgaaggcaagttgtttcaactaccgtcattgccgccc
tggaaaacaccaaggttcaacaaagccaactttaacaattttaccacaccgctacggaaa
aggtcgacaagggtaataaatgatgattcgatgcccataacaggcgaagtactagaggag
aggactgcagatgatctctatgggataaatatggacgtagacgaagtcgactatctgaat
actttgagccacatcgaggaagaaaagcaatacgattattcaccgttttgtgagcgcaat
acgctaagggaaagtagaattgacagttttttgaaagccgaaagggcagcacattgtctt
gtgtttcataaggtgggccatctagacggcatagacagctatcgacccgatattgacatc
atgtgcggcgaagaggctaataaatatgacagtgcgaatccggagggcaatggttcaatg
ttgttagagagtgtacctggatgcaacaaagaagacctggagaggttatcaaggcgagaa
tttgtaacaaattcgaaacctaatatgagacggttggatgacataataaatcatgaaacg
aacgccttaaaaagtttctggaacgactcaggattagtcaattcactccaaagtcatcat
ttgcatgaagagtaccttcttttgcaagaagaattaaagaatgtgtacaagattaaatgc
catgacagagtgccaatagaaagtctacgcgataagtgcagaagacactatagcaacgag
gatagttcgtttctctga

DBGET integrated database retrieval system