KEGG   Saccharomyces cerevisiae (budding yeast): YLR103CHelp
Entry
YLR103C           CDS       T00005                                 

Gene name
CDC45, SLD4
Definition
Cdc45p
Orthology
K06628  
cell division control protein 45
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR103C (CDC45)
   04113 Meiosis - yeast
    YLR103C (CDC45)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(343989..345941)
Genome map
AA seq 650 aa AA seqDB search
MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVP
IFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDI
YVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDEND
NNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEY
YSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVK
RLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLH
KMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSIS
ASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLS
WDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYR
NPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKP
ILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtattatggaatcagccagtttagcgaagcctacaacaaaatcttaaggaattcatcg
tctcattcatcatgtcaattggtcattttcgtttcttgtcttaacatcgatgcgctgtgt
gcgacgaagatgttgtcactattattcaaaaaacaattggtacaatctcaaatagtaccg
atatttgggtactctgaattacgacgccactattctcaattggatgacaatataaatagt
ctgctattagtagggtttggaggcgttattgatctggaggctttcttagaaatcgatccc
caagagtatgttatcgatacagatgaaaagtcgggggaacaaagtttcaggagagacatc
tacgtgttggatgctcatagaccgtggaatctcgacaatatatttggatcacaaatcatc
caatgttttgacgacggtacggtggatgacacattaggcgaacaaaaagaagcatactat
aaattgcttgaactggacgaggagagtggtgacgatgagctctcaggtgacgagaacgat
aataatgggggtgacgatgaggcaactgatgccgatgaagtcacagacgaggacgaagaa
gacgaagatgagacaatatctaataaaagaggtaattcttcaataggaccgaatgatctc
tcaaaaagaaagcaacgaaagaagcaaatccatgaatatgaaggtgttttggaggaatac
tattctcaaggcacaacagtggttaactcgatatctgcacaaatctattcattattgtct
gctatcggagaaacaaatctttcaaacctgtggttgaatatacttggtacgacctcgtta
gatatagcatatgctcaagtttacaatcgattataccccttattgcaagatgaagtgaag
cgtctcacaccaagcagtagaaactcagtaaagacccctgatacattgacgttaaacatc
caaccggattactaccttttcttactgaggcattcttcattgtacgacagtttttattat
tctaactatgtcaatgccaaactatccctatggaatgaaaatgggaaaaagagattgcat
aagatgtttgctagaatgggtataccattaagtactgcacaagaaacatggttatacatg
gatcattctattaagagagaacttgggataatatttgacaaaaatttggatcgttatggg
ttgcaagatataattagagatgggtttgttagaactcttggatatcgtgggtccataagt
gccagtgaatttgtcgaagcactaacagctcttttggaagtaggtaattcaactgataag
gatagtgtgaaaataaataatgacaataatgacgatacagatggagaggaagaagaagat
aacagcgctcaaaaattgacgaatttgagaaaaagatgggtttcgaatttttggctcagt
tgggatgctctagatgacagaaaggtggaactattaaaccgtggcattcaactagcacaa
gacttacagagagcaatttttaataccggggttgctatattggagaagaaattaatcaag
catttaagaatttatagattatgcgtcttacaagacggacccgatttagacttgtacaga
aacccattgacgttattaagattaggaaattggctcatagaatgctgtgcggaatctgaa
gacaagcaattgttgcccatggtgcttgccagcatagatgaaaatacggacacttacttg
gttgctgggttaacacctaggtatcctcgcggactagacacgatacacacaaaaaaacct
attttgaataatttcagcatggcgtttcaacaaataactgcagaaacggatgctaaagtg
agaatagataattttgaaagttccataattgaaatacgtcgtgaagatctttcaccattc
ctggagaagctgaccttgagtggattgttataa

DBGET integrated database retrieval system