KEGG   Saccharomyces cerevisiae (budding yeast): YLR103CHelp
Entry
YLR103C           CDS       T00005                                 

Gene name
CDC45, SLD4
Definition
(RefSeq) DNA replication initiation factor CDC45
  KO
K06628  
cell division control protein 45
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR103C (CDC45)
   04113 Meiosis - yeast
    YLR103C (CDC45)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   Other initiation factors
    YLR103C (CDC45)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:complement(343989..345941)
Genome map
AA seq 650 aa AA seqDB search
MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVP
IFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDI
YVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDEND
NNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEY
YSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVK
RLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLH
KMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSIS
ASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLS
WDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYR
NPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKP
ILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtattatggaatcagccagtttagcgaagcctacaacaaaatcttaaggaattcatcg
tctcattcatcatgtcaattggtcattttcgtttcttgtcttaacatcgatgcgctgtgt
gcgacgaagatgttgtcactattattcaaaaaacaattggtacaatctcaaatagtaccg
atatttgggtactctgaattacgacgccactattctcaattggatgacaatataaatagt
ctgctattagtagggtttggaggcgttattgatctggaggctttcttagaaatcgatccc
caagagtatgttatcgatacagatgaaaagtcgggggaacaaagtttcaggagagacatc
tacgtgttggatgctcatagaccgtggaatctcgacaatatatttggatcacaaatcatc
caatgttttgacgacggtacggtggatgacacattaggcgaacaaaaagaagcatactat
aaattgcttgaactggacgaggagagtggtgacgatgagctctcaggtgacgagaacgat
aataatgggggtgacgatgaggcaactgatgccgatgaagtcacagacgaggacgaagaa
gacgaagatgagacaatatctaataaaagaggtaattcttcaataggaccgaatgatctc
tcaaaaagaaagcaacgaaagaagcaaatccatgaatatgaaggtgttttggaggaatac
tattctcaaggcacaacagtggttaactcgatatctgcacaaatctattcattattgtct
gctatcggagaaacaaatctttcaaacctgtggttgaatatacttggtacgacctcgtta
gatatagcatatgctcaagtttacaatcgattataccccttattgcaagatgaagtgaag
cgtctcacaccaagcagtagaaactcagtaaagacccctgatacattgacgttaaacatc
caaccggattactaccttttcttactgaggcattcttcattgtacgacagtttttattat
tctaactatgtcaatgccaaactatccctatggaatgaaaatgggaaaaagagattgcat
aagatgtttgctagaatgggtataccattaagtactgcacaagaaacatggttatacatg
gatcattctattaagagagaacttgggataatatttgacaaaaatttggatcgttatggg
ttgcaagatataattagagatgggtttgttagaactcttggatatcgtgggtccataagt
gccagtgaatttgtcgaagcactaacagctcttttggaagtaggtaattcaactgataag
gatagtgtgaaaataaataatgacaataatgacgatacagatggagaggaagaagaagat
aacagcgctcaaaaattgacgaatttgagaaaaagatgggtttcgaatttttggctcagt
tgggatgctctagatgacagaaaggtggaactattaaaccgtggcattcaactagcacaa
gacttacagagagcaatttttaataccggggttgctatattggagaagaaattaatcaag
catttaagaatttatagattatgcgtcttacaagacggacccgatttagacttgtacaga
aacccattgacgttattaagattaggaaattggctcatagaatgctgtgcggaatctgaa
gacaagcaattgttgcccatggtgcttgccagcatagatgaaaatacggacacttacttg
gttgctgggttaacacctaggtatcctcgcggactagacacgatacacacaaaaaaacct
attttgaataatttcagcatggcgtttcaacaaataactgcagaaacggatgctaaagtg
agaatagataattttgaaagttccataattgaaatacgtcgtgaagatctttcaccattc
ctggagaagctgaccttgagtggattgttataa

DBGET integrated database retrieval system