KEGG   Saccharomyces cerevisiae (budding yeast): YLR113WHelp
Entry
YLR113W           CDS       T00005                                 

Gene name
HOG1, SSK3
Definition
mitogen-activated protein kinase HOG1 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR113W (HOG1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YLR113W (HOG1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   YLR113W (HOG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:371620..372927
Genome map
AA seq 435 aa AA seqDB search
MTTNEEFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDV
INTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHP
YSAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGSDGQIDISATFD
DQVAAATAAAAQAQAQAQAQVQLNMAAHSHNGAGTTGNDHSDIAGGNKVSDHVAANDTIT
DYGNQAIQYANEFQQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaacgaggaattcattaggacacagatattcggtacagttttcgagatcaca
aatagatacaatgatttaaaccccgttgggatgggggcatttgggttggtttgctcagcc
acggacactttgacatctcagccagttgccattaagaaaatcatgaaacctttttccact
gcagtgctggccaaaaggacatatcgtgaactaaaactactaaaacatctaagacacgag
aacttgatttgccttcaggacatatttctttctccattggaagatatatattttgtcacg
gaattacaaggaacagatttacatagactcttgcaaacaagacccttggaaaagcaattt
gttcagtatttcctataccaaattctaaggggtttaaaatacgttcactccgcgggcgtc
attcatagagatttgaaaccgagcaacattctgattaatgaaaactgtgatttgaagatt
tgcgatttcggtctagcaagaattcaagaccctcaaatgacaggctatgtttccactaga
tactacagggcacctgaaatcatgctaacgtggcaaaaatatgacgtcgaggtcgacatt
tggtccgctggttgtatttttgccgaaatgattgaaggtaagcctttgttccctgggaaa
gatcatgttcaccaattttcgatcatcactgacttgttgggatctccgccaaaggatgtg
ataaatactatttgttccgaaaatactctaaaatttgttacttcgttaccacacagagat
ccaattccattttctgaaagatttaaaacagtcgaacctgatgccgtagaccttttggaa
aaaatgctggtttttgatcctaagaagagaatcactgcggcggatgccttggctcatcct
tattcggctccttaccacgatccaacggatgaaccagtagccgatgccaagttcgattgg
cactttaatgacgctgatctgcctgtcgatacctggcgtgttatgatgtactcagaaatc
ctagacttccataagattggtggcagtgatggacagattgatatatctgccacgtttgat
gaccaagttgctgcagccaccgctgccgcggcgcaggcacaggctcaggctcaggctcaa
gttcagttaaacatggctgcgcattcgcataatggcgctggcactactggaaatgatcac
tcagatatagctggtggaaacaaagtcagcgatcatgtagctgcaaatgacaccattacg
gactacggtaaccaggccatacagtacgctaatgagttccaacagtaa

DBGET integrated database retrieval system