KEGG   Saccharomyces cerevisiae (budding yeast): YLR133WHelp
Entry
YLR133W           CDS       T00005                                 

Gene name
CKI1
Definition
bifunctional choline kinase/ethanolamine kinase CKI1 (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YLR133W (CKI1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     YLR133W (CKI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:408445..410193
Genome map
AA seq 582 aa AA seqDB search
MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLR
AVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLK
QDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPN
IDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIA
RRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFM
DIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPSSTSLTSQ
SSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDYNN
AKAPHQCHADRYPDKEQVLNFLYSYVSHLRGGAKEPIDEEVQRLYKSIIQWRPTVQLFWS
LWAILQSGKLEKKEASTAITREEIGPNGKKYIIKTEPESPEEDFVENDDEPEAGVSIDTF
DYMAYGRDKIAVFWGDLIGLGIITEEECKNFSSFKFLDTSYL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagaatcacgtccagggagtgtaagaagttactcggtcggttaccaagcaagg
tccagatcgagttctcaaagaagacattcgttaacacgccaacgttcctcgcaaagactg
attagaaccatcagtatcgagtctgatgtgtctaatattactgacgatgacgatttgaga
gctgtcaatgagggagtagcgggtgtgcaactggacgtctctgaaaccgcaaataaggga
ccaagaagagcatcagcaactgatgtcacagatagtttgggttcgacttcgtcggaatat
attgagattccctttgttaaggaaacattggatgcaagtttaccttcggattatctgaag
caggacatattaaatctcattcagagtttgaagatatccaaatggtataacaacaagaaa
atccaaccggtagcacaagatatgaacttagtcaagatctctggtgcgatgacaaacgca
attttcaaagttgaataccctaagttaccatcgttgctattgagaatatacggaccgaat
attgataatatcattgacagggaatatgaattgcagattttggctaggctttcattgaaa
aatataggtccttccctttacggctgttttgtaaacggtagatttgagcagtttctggag
aattctaagactttaacaaaagacgacattagaaactggaagaactctcaaaggattgca
aggagaatgaaggagttacatgtaggtgttcctctcttgagttcagaaaggaagaacggg
tcggcttgttggcaaaagattaaccagtggttgcgcacgattgagaaagtcgaccaatgg
gtgggggatcctaaaaacattgaaaactctttattatgtgagaattggtccaagtttatg
gatattgtcgatagatatcacaagtggcttatttctcaagaacagggtatagagcaagtc
aacaaaaatcttatattctgccataatgatgcccaatacggcaatttacttttcactgct
cctgtgatgaacacaccgagcctatacactgcaccttcgtctacatcattgacttcccaa
tcaagttccttatttccttcgagctccaatgtcattgtagatgatataatcaacccgcca
aagcaggagcaaagccaagattccaaattggtcgtcattgattttgaatatgcaggtgcc
aatcccgccgcatatgatttagcgaatcatctttccgagtggatgtatgattacaacaat
gctaaggccccacatcagtgccacgctgatagatatcccgataaagaacaggttttgaat
ttcttatactcttatgtttcgcatctaaggggtggtgctaaggaacccatagatgaagag
gttcaaagactctataagtcaatcattcaatggagacccactgtacaactattttggtcg
ctctgggccatcctacaaagtggtaaattagagaaaaaagaagcctccactgccatcact
agagaagaaattggacccaatggaaaaaaatatatcatcaagactgaacccgaatcccct
gaagaagactttgttgaaaatgacgacgagcctgaagctggcgtcagcattgacacgttc
gattatatggcttatggtcgtgacaagattgcggtcttttggggcgacctcattggctta
ggcataatcaccgaagaagaatgcaaaaatttcagctctttcaagttcctcgatactagt
tatttgtaa

DBGET integrated database retrieval system