KEGG   Saccharomyces cerevisiae (budding yeast): YLR133WHelp
Entry
YLR133W           CDS       T00005                                 

Gene name
CKI1
Definition
bifunctional choline kinase/ethanolamine kinase CKI1 (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sce00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:408445..410193
Genome map
AA seq 582 aa AA seqDB search
MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLR
AVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLK
QDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPN
IDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIA
RRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFM
DIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPSSTSLTSQ
SSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDYNN
AKAPHQCHADRYPDKEQVLNFLYSYVSHLRGGAKEPIDEEVQRLYKSIIQWRPTVQLFWS
LWAILQSGKLEKKEASTAITREEIGPNGKKYIIKTEPESPEEDFVENDDEPEAGVSIDTF
DYMAYGRDKIAVFWGDLIGLGIITEEECKNFSSFKFLDTSYL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagaatcacgtccagggagtgtaagaagttactcggtcggttaccaagcaagg
tccagatcgagttctcaaagaagacattcgttaacacgccaacgttcctcgcaaagactg
attagaaccatcagtatcgagtctgatgtgtctaatattactgacgatgacgatttgaga
gctgtcaatgagggagtagcgggtgtgcaactggacgtctctgaaaccgcaaataaggga
ccaagaagagcatcagcaactgatgtcacagatagtttgggttcgacttcgtcggaatat
attgagattccctttgttaaggaaacattggatgcaagtttaccttcggattatctgaag
caggacatattaaatctcattcagagtttgaagatatccaaatggtataacaacaagaaa
atccaaccggtagcacaagatatgaacttagtcaagatctctggtgcgatgacaaacgca
attttcaaagttgaataccctaagttaccatcgttgctattgagaatatacggaccgaat
attgataatatcattgacagggaatatgaattgcagattttggctaggctttcattgaaa
aatataggtccttccctttacggctgttttgtaaacggtagatttgagcagtttctggag
aattctaagactttaacaaaagacgacattagaaactggaagaactctcaaaggattgca
aggagaatgaaggagttacatgtaggtgttcctctcttgagttcagaaaggaagaacggg
tcggcttgttggcaaaagattaaccagtggttgcgcacgattgagaaagtcgaccaatgg
gtgggggatcctaaaaacattgaaaactctttattatgtgagaattggtccaagtttatg
gatattgtcgatagatatcacaagtggcttatttctcaagaacagggtatagagcaagtc
aacaaaaatcttatattctgccataatgatgcccaatacggcaatttacttttcactgct
cctgtgatgaacacaccgagcctatacactgcaccttcgtctacatcattgacttcccaa
tcaagttccttatttccttcgagctccaatgtcattgtagatgatataatcaacccgcca
aagcaggagcaaagccaagattccaaattggtcgtcattgattttgaatatgcaggtgcc
aatcccgccgcatatgatttagcgaatcatctttccgagtggatgtatgattacaacaat
gctaaggccccacatcagtgccacgctgatagatatcccgataaagaacaggttttgaat
ttcttatactcttatgtttcgcatctaaggggtggtgctaaggaacccatagatgaagag
gttcaaagactctataagtcaatcattcaatggagacccactgtacaactattttggtcg
ctctgggccatcctacaaagtggtaaattagagaaaaaagaagcctccactgccatcact
agagaagaaattggacccaatggaaaaaaatatatcatcaagactgaacccgaatcccct
gaagaagactttgttgaaaatgacgacgagcctgaagctggcgtcagcattgacacgttc
gattatatggcttatggtcgtgacaagattgcggtcttttggggcgacctcattggctta
ggcataatcaccgaagaagaatgcaaaaatttcagctctttcaagttcctcgatactagt
tatttgtaa

DBGET integrated database retrieval system