KEGG   Saccharomyces cerevisiae (budding yeast): YLR153CHelp
Entry
YLR153C           CDS       T00005                                 

Gene name
ACS2
Definition
(RefSeq) acetate--CoA ligase ACS2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00620  Pyruvate metabolism
sce00640  Propanoate metabolism
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YLR153C (ACS2)
   00620 Pyruvate metabolism
    YLR153C (ACS2)
   00640 Propanoate metabolism
    YLR153C (ACS2)
  Energy metabolism
   00680 Methane metabolism
    YLR153C (ACS2)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YLR153C (ACS2)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YLR153C (ACS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 850846
NCBI-ProteinID: NP_013254
SGD: S000004143
UniProt: P52910
Position
XII:complement(445524..447575)
Genome map
AA seq 683 aa AA seqDB search
MTIKEHKVVYEAHNVKALKAPQHFYNSQPGKGYVTDMQHYQEMYQQSINEPEKFFDKMAK
EYLHWDAPYTKVQSGSLNNGDVAWFLNGKLNASYNCVDRHAFANPDKPALIYEADDESDN
KIITFGELLRKVSQIAGVLKSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAG
FSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEGLNGVDLVSRILVFQRTGTEG
IPMKAGRDYWWHEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPDYGRYWRII
QRHKATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKN
CVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGINACIIDPVTGVELEGNDVEGVL
AVKSPWPSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITP
DNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLRKVASNEAEQLGDLTTL
ANPEVVPAIISAVENQFFSQKKK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaaggaacataaagtagtttatgaagctcacaacgtaaaggctcttaaggct
cctcaacatttttacaacagccaacccggcaagggttacgttactgatatgcaacattat
caagaaatgtatcaacaatctatcaatgagccagaaaaattctttgataagatggctaag
gaatacttgcattgggatgctccatacaccaaagttcaatctggttcattgaacaatggt
gatgttgcatggtttttgaacggtaaattgaatgcatcatacaattgtgttgacagacat
gcctttgctaatcccgacaagccagctttgatctatgaagctgatgacgaatccgacaac
aaaatcatcacatttggtgaattactcagaaaagtttcccaaatcgctggtgtcttaaaa
agctggggcgttaagaaaggtgacacagtggctatctatttgccaatgattccagaagcg
gtcattgctatgttggctgtggctcgtattggtgctattcactctgttgtctttgctggg
ttctccgctggttcgttgaaagatcgtgtcgttgacgctaattctaaagtggtcatcact
tgtgatgaaggtaaaagaggtggtaagaccatcaacactaaaaaaattgttgacgaaggt
ttgaacggagtcgatttggtttcccgtatcttggttttccaaagaactggtactgaaggt
attccaatgaaggccggtagagattactggtggcatgaggaggccgctaagcagagaact
tacctacctcctgtttcatgtgacgctgaagatcctctatttttattatacacttccggt
tccactggttctccaaagggtgtcgttcacactacaggtggttatttattaggtgccgct
ttaacaactagatacgtttttgatattcacccagaagatgttctcttcactgccggtgac
gtcggctggatcacgggtcacacctatgctctatatggtccattaaccttgggtaccgcc
tcaataattttcgaatccactcctgcctacccagattatggtagatattggagaattatc
caacgtcacaaggctacccatttctatgtggctccaactgctttaagattaatcaaacgt
gtaggtgaagccgaaattgccaaatatgacacttcctcattacgtgtcttgggttccgtc
ggtgaaccaatctctccagacttatgggaatggtatcatgaaaaagtgggtaacaaaaac
tgtgtcatttgtgacactatgtggcaaacagagtctggttctcatttaattgctcctttg
gcaggtgctgtcccaacaaaacctggttctgctaccgtgccattctttggtattaacgct
tgtatcattgaccctgttacaggtgtggaattagaaggtaatgatgtcgaaggtgtcctt
gccgttaaatcaccatggccatcaatggctagatctgtttggaaccaccacgaccgttac
atggatacttacttgaaaccttatcctggtcactatttcacaggtgatggtgctggtaga
gatcatgatggttactactggatcaggggtagagttgacgacgttgtaaatgtttccggt
catagattatccacatcagaaattgaagcatctatctcaaatcacgaaaacgtctcggaa
gctgctgttgtcggtattccagatgaattgaccggtcaaaccgtcgttgcatatgtttcc
ctaaaagatggttatctacaaaacaacgctactgaaggtgatgcagaacacatcacacca
gataatttacgtagagaattgatcttacaagttaggggtgagattggtcctttcgcctca
ccaaaaaccattattctagttagagatctaccaagaacaaggtcaggaaagattatgaga
agagttctaagaaaggttgcttctaacgaagccgaacagctaggtgacctaactactttg
gccaacccagaagttgtacctgccatcatttctgctgtagagaaccaatttttctctcaa
aaaaagaaataa

DBGET integrated database retrieval system