KEGG   Saccharomyces cerevisiae (budding yeast): YLR160CHelp
Entry
YLR160C           CDS       T00005                                 

Gene name
ASP3-4, ASP3
Definition
asparaginase ASP3-4 (EC:3.5.1.1)
Orthology
K01424  
L-asparaginase [EC:3.5.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sce00250]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:sce00460]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(486201..487289)
Genome map
AA seq 362 aa AA seqDB search
MRSLNTLLLSLFVAMSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVG
LTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTH
GTDTMEETAFFLDLTINSEKPVCIAGAMRPATATSADGPMNLYQAVSIAASEKSLGRGTM
ITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNL
TDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY
GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFSGVY
GG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagatctttaaatacccttttactttctctctttgtcgcaatgtccagtggtgctcca
ctactaaaaattcgtgaagagaagaattcttctttgccatcaatcaaaatttttggtacc
ggcggtactatcgcttccaagggttcgacaagtgcaacaacggcgggttatagcgtggga
ttaaccgtaaatgatttaatagaagccgtcccatctttagctgagaaggcaaatctggac
tatcttcaagtgtctaacgttggttcaaattctttaaactatacgcatctgatcccattg
tatcacggtatctccgaggcactagcctctgatgactacgctggtgcggttgtcactcat
gggaccgacactatggaggagacagctttcttcttagatttgaccataaattcagagaag
ccagtatgtatcgcaggcgctatgcgtccagccactgccacgtctgctgatggcccaatg
aatttatatcaagcagtgtctattgctgcttctgagaaatcactgggtcgtggcacgatg
atcactctaaacgatcgtattgcctctgggttttggacaacgaaaatgaatgccaactct
ttagatacattcagagcggatgaacagggatatttaggttacttttcaaatgatgacgtg
gagttttactacccaccagtcaagccaaatggatggcaattttttgacatttccaacctc
acagacccttcggaaattccagaagtcattattctgtactcctatcaaggcttgaatcct
gagctaatagtaaaggccgtcaaggacctgggcgcaaaaggtatcgtgttggcgggttct
ggagctggttcctggactgctacgggtagtattgtaaacgaacaactttatgaagagtat
ggtataccaattgttcacagcagaagaacagcagatggtacagttcctccagatgatgcc
ccagagtacgccattggatctggctacctaaaccctcaaaaatcgcgtattttgctacaa
ttatgtttgtactccggctacggcatggatcagattaggtctgttttttctggcgtctac
ggtggttaa

DBGET integrated database retrieval system