KEGG   Saccharomyces cerevisiae (budding yeast): YLR176CHelp
Entry
YLR176C           CDS       T00005                                 

Gene name
RFX1, CRT1
Definition
Rfx1p
Orthology
K09175  
regulatory factor X, other
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR176C (RFX1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Other basic domains
   RF-X
    YLR176C (RFX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(507797..510232)
Genome map
AA seq 811 aa AA seqDB search
MVIFKERKPTENLFTRKIPAKYFIFSPSFLSVHYFEFYLPMSGDNNIEPTSRGSNDNSNG
PSNGSSVNSNRYSLNAPKYSSQPPPASHTYLPPMSVNIPPIASKSSSIYSLLHQSSPRPE
TPNPILPPLIGSGPGSHKPSPTPTQPPAQPATQRQPATYSVYPASISLNRSNSSAYPLSF
KSEETLNNNPPTAAKRTNTFPSIPSSTKKQKTSQEKRISSISRRNTQEIIAKQIAENNKS
KTIEEYAQIVKHAEIKVLSMDSQNTSKAALQLAEQNRERERQVFALLWLMKNCKSQHDSY
VPRGKIFAQYASSCSQNNLKPLSQASLGKLIRTVFPDLTTRRLGMRGQSKYHYCGLKLTV
NESGSVSLNNNNASLSLVHNNDPISPLSSPSPSSPSPQVPNVSSPFSLNRKSLSRTGSPV
KQSSNDNPNEPELESQHPNETEANKLDSLPPAANNPTGTLSSDELTFTHDLIEKVFNCND
KLSDNYNTQILSNTEHPLLTSYKLDFPKIPAGVLPTDTDSDVISSLESLYHIHCNSVYEC
IKFLKSDNISNALFFSNSNSISPTMFNLFISEPLIDWVTKCDLITYTGLIKFFSQFIIHS
NEISDSIIQKLESMIKLLPEQINKAVLELPKALVQRKLSIINNFTKLVKKLIKLLKFILN
FLKSFPIFKSGMNNDWKNIVNLDDILEMMINEDDTNSETNTIMQHLQGFCQVFVTKFLNS
SMSVSNDPSVSIECKSLNEMIKDFCSFISLQSKFSCLKLIDCSTRFRNAIIGDISLKSNE
NLLSWLFLNNVMGQLLNYCFEVMKFVNGLKV
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcttcaaagaacgcaaaccaacagaaaaccttttcactagaaaaatacctgcc
aagtacttcatcttctcgcctagttttttgtctgttcattattttgaattttatttgccc
atgtccggtgataataacattgaacctactagtcggggctcgaacgacaatagcaacggt
ccaagtaacggatcttcggtaaacagtaatcggtacagtttaaacgcacccaagtacagc
agccaaccaccgccagcatcacacacttatttgccccccatgtcagtgaatatcccgccc
atagcgagcaaatcatcgtcaatatacagcctgctacaccaaagttccccccgcccggag
acgccaaatccaatattaccgccacttatcggtagtggtcccggctcccataaaccatct
cctacccctacacagcctcctgcacaacccgcaacacaacggcaacctgccacatactca
gtgtatccagcgtctatcagcctgaatagatcgaattcatctgcttacccactttctttc
aagtcagaggaaaccttaaacaataatcctcctactgctgccaaacgtaccaataccttc
ccctcaattccaagcagtacgaaaaaacagaaaacaagccaagagaaacgaatctcttcc
atttcaaggagaaacacgcaagaaataattgctaagcaaattgcagaaaataacaaatct
aaaaccatcgaggagtatgcgcagatcgtgaagcatgcagaaatcaaagtcctgagcatg
gactcacagaacacttcaaaggcagctttgcagctggcggaacaaaacagagaaagagaa
agacaagtgtttgcgttactttggttaatgaaaaattgtaaatctcagcacgatagttac
gtaccaagaggcaaaatatttgctcaatacgcttcatcttgttcccaaaacaacctgaag
cccttatcacaggcgtcattagggaagttgataagaacagtttttcctgatttaacgact
agaaggctgggtatgagaggtcaatccaaataccactactgcggattgaaactaactgtc
aacgaaagcggctccgtgtcccttaataacaacaatgcttcgttatccttagtacacaat
aacgatcccatatcgcccctatcgtctccatcgccctcttcaccttcgccgcaggtacct
aacgtttcatcgccgttctcattaaatagaaaaagtctttctcgaactgggtcgcccgtt
aaacagagtagtaatgacaaccctaacgaaccagaactcgaatcacagcatccaaacgaa
acagaagcaaataaactagattcgctgccaccagcggcaaataaccctaccggaacactg
tcttcagatgaattaactttcactcatgatttaattgaaaaagttttcaattgtaatgac
aagctatcagataactataatacccaaatattatcgaacacagaacatccgcttttgaca
tcatataagttagacttcccaaaaattcccgcaggtgtactccccacagacactgattcg
gatgttatatcatccttggagtcattatatcatatccattgcaactccgtttatgaatgc
atcaagtttctgaagagtgataatatatcaaatgcattattcttctctaactctaactct
atatcgcccacgatgtttaatctattcatttctgagccattgattgattgggtaactaaa
tgtgacttaatcacctatacagggttaatcaaatttttttcacaatttataattcattct
aatgagatcagtgactcaatcattcaaaaactggaaagtatgatcaagctattgcccgaa
caaattaataaggctgttttagaattaccaaaagcgctagtgcaaaggaagttatcaatt
attaataattttaccaaactagtgaaaaaactaataaagttattaaaattcattctaaac
ttcttgaaaagttttcctatatttaaaagtggcatgaataatgactggaagaatattgta
aatttagacgatattttggaaatgatgattaatgaagacgatacaaattcagagacaaac
acaataatgcaacatttacaagggttctgtcaagttttcgtaacaaagttcttaaattcc
tctatgagcgttagcaatgatccctctgtgtctatcgaatgcaagtccttaaatgaaatg
attaaagatttttgttcctttatttccctacaaagcaaattttcgtgcttgaaattaatt
gattgcagcacaagattcaggaatgcaataatcggcgatattagcttaaaatcaaatgag
aatttgctatcatggttgtttctaaataatgtcatgggccaattgctgaactactgtttt
gaagtcatgaaattcgtcaatggcctaaaagtttaa

DBGET integrated database retrieval system