KEGG   Saccharomyces cerevisiae (budding yeast): YLR182WHelp
Entry
YLR182W           CDS       T00005                                 

Gene name
SWI6, PSL8, SDS11
Definition
Swi6p
Orthology
K06648  
regulatory protein SWI6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR182W (SWI6)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR182W (SWI6)
   04113 Meiosis - yeast
    YLR182W (SWI6)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   ZIP only
    YLR182W (SWI6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:517940..520351
Genome map
AA seq 803 aa AA seqDB search
MALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEE
RNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSH
SKLPENKTKSENSKDNISSKRINNLQDMSLDSDAHRELGSPLKKLKIDTSVIDAESDSTP
NTARGKPNDDINKGPSGDNENNGTDDNDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPV
VNDNEQKMKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVN
DAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVK
SVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIV
KKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARL
GNISIVDALLDYGADPFIANKSGLRPVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNG
KAKKIRSQLLKNPPETTSLINDVQNLLNSISKDYENETVQYNEKLEKLHKELNEQREELA
NSREQLANVKQLKDEYSLMQEQLTNLKAGIEEEEESFREESKKLGIIADESSGIDWDSSE
YDADEPFKVEFLSDFLEDKLQKNYEGDISKLLEAESKEQIMEQIRNQLPAEKIQSMLPPT
VLLKARINAYKRNDKHLTNVLDTISTKQSELENKFRRVLSLCLKIDENKVDNMLDGLLQA
ISSEDPQDIDTDEMQDFLKKHAS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggaagaagtggtacgatacttaggacctcacaatgagatccctttgacactc
actagagactcggagactggccatttcctcctgaaacattttctgcccattttgcagcaa
tatcatgacacggggaatattaacgagaccaaccccgatagtttccccactgatgaggaa
agaaataaattactggcacattatggaattgctgtaaatacagacgaccgaggtgagtta
tggatagagctggaaaaatgtttacaattattaaacatgctaaatttattcggtttgttc
caggatgcattcgaatttgaggagcctgaaacagatcaggatgaagaagatcccagccat
tcgaaactaccagaaaacaagaccaaaagtgaaaattctaaggataatatcagctcaaag
aggattaataatttacaagatatgagcctggattctgatgcacacagagaattaggctct
cctttaaaaaaactaaaaatagatacctctgtaatagatgctgagagtgactccactccg
aatactgccagaggcaagcctaacgatgatattaataagggccctagcggcgacaatgaa
aataatggcactgatgacaatgacagaaccgctggacctatcataacattcactcatgac
ctaacttctgactttttaagcagtccactgaaaatcatgaaagcactaccttctccagtt
gtaaatgataatgaacagaagatgaaactagaggcattcttacaacggttgttatttcca
gaaattcaagaaatgcctacatcccttaataatgacagcagtaatagaaattcagaaggg
gggagctcaaaccaacaacaacagcacgtatcatttgatagccttttgcaagaggtaaac
gacgcttttcctaatactcaattaaatcttaatattcctgtagatgagcatggaaacaca
ccattacattggctgacttcaatagcaaacctggaattagtgaaacacctggttaagcat
ggttcaaacagattatatggtgataatatgggggagtcatgcctagtgaaagctgtcaaa
tcagtaaataattacgactctggtacttttgaggcacttctagattatttatatccatgt
ttaattttggaagactcaatgaatagaacaattttgcaccatatcattattacgtctggt
atgactggctgttcagcagctgcgaaatattatttagatattttaatgggatggattgtc
aagaaacaaaatagacccattcaaagtggtactaacgaaaaagaaagcaaaccgaatgac
aaaaatggggaaagaaaggactctatactagaaaatttggacctgaaatggataatagca
aacatgctcaatgcgcaggactctaatggcgatacttgcttgaacattgcagcaagattg
ggaaacatttcaatagtagacgctttattagattacggtgctgacccatttattgcaaac
aaatcagggttgagacccgtggattttggggcaggtacttcaaaattacaaaatacgaac
ggcggtgacgaaaactcgaagatggtctctaagggtgattacgacggtcaaaaaaatgga
aaggccaaaaaaataaggtctcaactgttgaaaaacccacctgaaacaacttcgttaatt
aatgatgtccaaaatttactgaattcaatctcgaaagattatgagaatgaaacagtgcaa
tataatgagaaattagaaaaactacacaaggaattgaacgaacagcgagaagaattagct
aattctagagaacaactagcaaatgtgaagcaattgaaagatgaatactcactaatgcaa
gagcaattgaccaatttaaaagcaggaattgaagaagaagaggaaagttttagggaagag
agcaaaaagctaggaataattgcagatgaaagttcaggtattgattgggactctagcgaa
tatgatgcagatgaacccttcaaagtagagttcctttcagatttcttggaggataaatta
caaaagaattatgaaggcgatatttccaaactattagaagcggagtcgaaagagcagata
atggaacagatacgaaatcaacttcccgcagaaaaaatccaatcgatgcttccaccaacg
gtcttattgaaggcaagaataaatgcatacaagcggaatgataaacacctaaccaatgta
ttggatacaatcagcaccaaacaatcagaattagagaataaatttagaagagtgttatct
ttatgtttgaaaatcgacgaaaataaagttgacaatatgcttgatggtttgttacaggcc
atatcttctgaagacccacaagacattgacactgacgaaatgcaagattttttaaaaaag
catgcttcatga

DBGET integrated database retrieval system