KEGG   Saccharomyces cerevisiae (budding yeast): YLR210WHelp
Entry
YLR210W           CDS       T00005                                 

Gene name
CLB4
Definition
Clb4p
Orthology
K06659  
G2/mitotic-specific cyclin 3/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR210W (CLB4)
   04113 Meiosis - yeast
    YLR210W (CLB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:562008..563390
Genome map
AA seq 460 aa AA seqDB search
MMLEGYTVQPPQSTLIGDIEIQDENANQEVKNVLYQGVQKGIKRLEKRQRRVALGDVTSQ
KANKIHNAIHNKFHQTKNNFEIENIRSSALVKEQQRDVRHEDSDYFLIDSSEGSSTDDEQ
VNEDAIDDLLSRRVNDQQIQADEVYEDFDGEMQDVIEEDVDSQIEPLSPINNDEIQTELD
RAFEKYFRSVPNPLDDDTHDVVMVVEYASDIFYYLRELEVKYRPNPYYMQNQVELTWPFR
RTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLVGVSALFIAAKFEEIN
CPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPMPFLRRISKADDYDFEPRTL
AKYLLETTIVEPKLVAAAPSWLAAGAYFLSRTILGSNDWSLKHVFYSGYTSSQIIPLASL
ILENCKNASRRHHSIWKKYFDQKHYRCSQIVEEWIVSTEA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgaagggtatacggtacaacctccacagtctactttgataggtgacattgaa
attcaggacgaaaatgcaaaccaagaagttaagaacgtactttaccaaggagttcaaaag
ggtataaaaaggctagaaaaaagacaaaggagggttgcattaggtgatgtaacctctcaa
aaggcaaacaaaatacacaatgctatacataataaattccatcagacgaagaacaatttt
gaaatagagaacatacgctcatcggccttggtaaaagaacaacaacgagacgtaaggcat
gaagatagcgactattttttaattgatagttctgaaggctcttctactgatgacgaacaa
gttaatgaagatgctattgatgatttgttaagtcgaagagtaaatgatcagcagattcaa
gccgatgaagtgtatgaagatttcgatggagaaatgcaagatgtcattgaagaggatgtt
gatagtcaaattgaaccactatcaccaataaacaacgatgaaattcagactgagctggac
agggcgtttgaaaaatattttcggtcggttcccaatccgctggatgatgatacccatgat
gttgtgatggttgtggagtacgcttccgacatattctattacttgagagaacttgaagtg
aaatataggcctaatccctactatatgcaaaatcaagtagagcttacatggccgttcaga
cgaactatgatagattggctagttcaactgcattttagatttcaacttttaccagaaacg
ctatacctgacgattaatatagtggatagatttctgtcaaagaagaccgttactttgaac
aggtttcaattggttggtgtatcggctttatttattgctgccaagtttgaagagattaac
tgccccactttggatgatctagtttacatgctggaaaatacatacactagagatgacatt
attagagcggaacagtatatgatagatactctggaatttgaaataggttggccaggaccc
atgccatttttaagaaggataagtaaagcagatgactatgacttcgaaccaagaacatta
gcaaagtacttattggaaactacaatagtagaacccaaactagtggctgcggcaccaagc
tggttagctgctggcgcgtattttctgagcagaacaattcttggttcaaatgattggtct
ttaaaacatgtattctactctggctatacatccagccaaataattcctttagcatcactg
atattggagaattgcaagaacgcatctcgacgccatcattcaatttggaaaaaatacttt
gaccaaaagcattaccgctgttctcaaattgtagaagaatggattgtttcgacagaagcc
taa

DBGET integrated database retrieval system