KEGG   Saccharomyces cerevisiae (budding yeast): YLR258WHelp
Entry
YLR258W           CDS       T00005                                 

Gene name
GSY2
Definition
glycogen (starch) synthase GSY2 (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YLR258W (GSY2)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     YLR258W (GSY2)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Storage polysaccharide
   YLR258W (GSY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XII:660716..662833
Genome map
AA seq 705 aa AA seqDB search
MSRDLQNHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDI
LDWKKPEAFSDEMRPVQHALQTMESRGVHFVYGRWLIEGAPKVILFDLDSVRGYSNEWKG
DLWSLVGIPSPENDFETNDAILLGYTVAWFLGEVAHLDSQHAIVAHFHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCASGSFDFYNCLESVDVDHEAGRFGIYHRYCIERAAAHS
ADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQNLHALKKEKINDFVRGH
FHGCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAK
NNSFTVEALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSS
DKVMLKRRILALRRPEGQLPPIVTHNMVDDANDLILNKIRQVQLFNSPSDRVKMIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDL
IETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVARPLSVPGSPRDLR
SNSTVYMTPGDLGTLQEVNNADDYFSLGVNPAADDDDDGPYADDS
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgacctacaaaaccatttgttattcgagactgcgactgaggttgctaatagg
gttggtggtatttactccgtgctaaaatcgaaggctcccattacggttgcccagtataaa
gaccattaccacttgatagggcccttaaataaagccacttatcaaaatgaagttgatata
ctagattggaagaagcctgaagccttttccgatgaaatgaggccagtgcagcatgccctg
caaacaatggaatctagaggagttcattttgtttatgggaggtggctgattgaaggtgct
ccaaaagtaatactttttgacttggattctgtgagaggttattcgaatgaatggaagggt
gatttatggtcattagtaggaattccctctcctgagaatgatttcgagacgaatgatgct
atcctattggggtatacagtcgcttggtttctaggcgaagtggctcatctcgattcacaa
cacgcaattgttgcgcactttcacgaatggttggccggtgttgcgttaccattatgccgt
aaaaggcgtatcgatgtagttaccattttcaccactcatgctactttattgggacggtat
ttatgcgcctccggcagtttcgatttttacaattgtttagaatctgttgatgttgatcac
gaagctggcagatttggcatataccatcgttattgtatagagagagcggcggctcattct
gcagacgtgttcactacggtgtcacaaataactgcttttgaagcggaacatcttttgaaa
agaaaaccagatgggattttgcctaatggactgaacgtcatcaaatttcaagcatttcat
gagttccaaaatttgcatgctttgaaaaaagaaaaaatcaatgactttgtaagaggccat
tttcatggttgcttcgatttcgatctagacaacaccttgtacttttttattgctggtaga
tatgagtataaaaataagggtgctgacatgtttattgaggctctagcgcgtttgaactac
agattaaaagtatccggatccaaaaaaactgtggtagcgtttattgtcatgcccgccaaa
aataattccttcactgttgaagcattgaagggccaggctgaggtgagggcgttagaaaat
actgtacatgaagtgactacttcaattggtaaaagaatattcgatcatgctatcaggtac
ccccacaatggactgacgacggaattaccaaccgatttgggtgaattactaaagagttcg
gataaagttatgttaaagagacgtattttggctttgagaaggccggagggacagttaccc
ccaatagttacacacaatatggtcgatgacgctaatgacctgattttaaataaaatcaga
caagttcaattgttcaatagcccaagtgatcgtgttaaaatgatcttccatccagaattt
ttgaacgctaataatccgatccttggtttagattatgatgagttcgttcgtggttgccat
ttgggtgttttcccttcatactacgagccttggggttacacacctgcagaatgtacagta
atgggtgttccctccatcacgacaaatgtctctggtttcggtgcctatatggaagacttg
atcgaaaccaaccaagcgaaagattacggtatttatattgtggatcgtcgtttcaaggca
cctgatgaatctgtggaacaattagttgactacatggaagaatttgtaaaaaagacaaga
aggcaaagaattaatcaaagaaatagaactgaaagactctccgacttactggactggaag
agaatgggtctcgaatacgtcaaggcaaggcagttagcattaagaagaggctatcctgat
cagttcagagagctcgttggtgaagaactaaatgattccaacatggatgctttagcaggc
ggaaagaaattgaaagttgcaagaccgcttagtgtacctggctcaccaagagatttgaga
tcaaacagcacagtctacatgacccctggtgatttgggtactctgcaggaggttaataac
gcggacgattatttttcattgggagtgaatcctgcagctgacgatgacgacgatggccca
tatgctgatgacagttaa

DBGET integrated database retrieval system