KEGG   Saccharomyces cerevisiae (budding yeast): YLR260WHelp
Entry
YLR260W           CDS       T00005                                 

Gene name
LCB5
Definition
sphinganine kinase LCB5 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    YLR260W (LCB5)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     YLR260W (LCB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:665844..667907
Genome map
AA seq 687 aa AA seqDB search
MTLKPSKRRKGRSRHSRKKQITSAILTEEGIMIKAKPSSPYTYANRMADKRSRSSIDNIS
RTSFQSNISRTSFQSNSDNNSIFETASLISCVTCLSDTDTIDRSETSTTDTSKDDLSANP
KLHYPSVNGQLPANTVIPYGRILDARYIEKEPLHYYDANSSPSSPLSSSMSNISEKCDLD
ELESSQKKERKGNSLSRGSNSSSSLLTSRSPFTKLVEVIFARPRRHDVVPKRVSLYIDYK
PHSSSHLKEEDDLVEEILKRSYKNTRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASR
CSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAI
TEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRIDLMCCSQPSYAREHPKLSFLSQTY
GLIAETDINTEFIRWMGPARFELGVAFNIIQKKKYPCEIYVKYAAKSKNELKNHYLEHKN
KGSLEFQHITMNKDNEDCDNYNYENEYETENEDEDEDADADDEDSHLISRDLADSSADQI
KEEDFKIKYPLDEGIPSDWERLDPNISNNLGIFYTGKMPYVAADTKFFPAALPSDGTMDM
VITDARTSLTRMAPILLGLDKGSHVLQPEVLHSKILAYKIIPKLGNGLFSVDGEKFPLEP
LQVEIMPRLCKTLLRNGRYVDTDFDSM
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaaaccttcaaagagacgtaagggcaggtctcgccattccaggaagaagcaa
ataacgtcagcgatactgactgaggaaggaataatgatcaaggcaaaaccatcaagtcct
tacacatacgcaaatagaatggcagataaacgaagtcgcagcagcattgacaacatcagt
agaactagctttcaaagcaacatcagtagaactagctttcaaagcaacagtgataacaac
agtatatttgaaacggcttcactaattagctgtgttacctgtttaagcgatactgataca
atagacagatcggaaacatcgacaacggatacaagtaaagatgatctttctgctaatcca
aaacttcattatccttcggtgaatggtcaattgccagcaaacaccgttatcccctatgga
cgaattctggatgccagatacattgaaaaggaacctctgcattattatgatgccaattca
tcacccagttcacctttaagcagctcaatgagtaacattagtgaaaagtgtgatcttgat
gaattagagtcttcccaaaaaaaagaaaggaagggcaactcgctatcgcgaggaagtaac
agtagtagtagcctcctgacttccagatctccttttacgaaactagtagaggttatattt
gctaggccaagacggcatgacgttgtacccaaaagggtttcattgtatattgactataaa
ccccattcatcttctcacttaaaagaagaagatgacttggttgaggagattttaaagaga
agctacaaaaacactagaaggaacaaatccatatttgtgatcattaatccgtttggtggt
aaaggtaaggcgaaaaaactgtttatgacaaaggcaaagccgttactattagcaagtcgg
tgttccatagaagtggtttatacaaaataccctggtcatgctatagagatcgcgcgggaa
atggatattgacaaatatgacactattgcttgcgcttcgggagatggcattcctcatgag
gtgatcaatgggttataccaaaggcctgatcatgtcaaagcattcaacaatatcgccatt
acagaaattccatgcggatcaggtaacgcaatgagcgtatcctgccactggacaaacaat
ccttcgtactcaactttatgcttaattaaatcgatagagactagaattgatttgatgtgt
tgttcgcagccttcttatgcaagagagcacccaaagttatcatttttaagtcaaacatat
ggtctcattgcagaaactgacataaacactgaatttattagatggatgggacctgcaagg
tttgaattgggtgtagccttcaatatcatacaaaaaaaaaaatatccttgtgagatatat
gtaaagtatgctgccaaatcaaaaaacgagttaaaaaatcattacctggaacacaaaaat
aaagggtcgttagaattccagcatattactatgaacaaagataacgaggattgtgataat
tacaattacgaaaatgaatacgaaaccgaaaacgaagatgaagatgaagatgcggatgcg
gatgacgaagactcccacttgatatctcgtgatctggcagattctagtgctgatcaaatt
aaagaggaagatttcaaaataaaatatccattagatgaaggtatccctagtgactgggaa
agattggatcctaatatttcgaacaacctaggtatcttctatacgggtaaaatgccatat
gtggctgctgacactaaattctttccggcagcgcttccttcagatggtacaatggatatg
gttatcaccgatgcaagaacctcgttgacgaggatggcaccaatcctgctgggactagat
aagggttcccatgttttacaaccggaagtcttacactctaaaattttggcatacaagata
ataccaaagctagggaacggcttgttctctgtcgatggcgagaaatttcctctagagccc
cttcaagtcgaaattatgccacgcttatgcaagacgttactgagaaatggccgttatgtg
gacacagatttcgattctatgtga

DBGET integrated database retrieval system