KEGG   Saccharomyces cerevisiae (budding yeast): YLR263WHelp
Entry
YLR263W           CDS       T00005                                 

Gene name
RED1
Definition
Red1p
Orthology
K12777  
protein RED1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YLR263W (RED1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:670340..672823
Genome map
AA seq 827 aa AA seqDB search
MEGLKKKIFGVCLKNDLAQTRNETKGIHYGLMTLETSKQLQEFLHLLVIKREVIQNFELL
FHIINVAVKITDSNLPSDDIWHFILKLRFSSEINIDEDSKVLNYLLETGIAMENPVSWKC
LAVISSILSSVPQSKKIITNLIETEHAKKIGQLFDNIQDLQQGNFLVEILSNCFKKSASN
SKKVEKIPQLWQSRSKNKFFFENEFYPFSSKNGSLQTCQFLCNNFMSTLSFTGILRQVSY
SGSETLKNLRIFKKKDDENSYFIQCIYNKIYLWLDEKAPLEFERKKIRITKNLKNKIQIK
LRQPFHECVRTTADKTALLFNKTKGFQLEFEDEKLGETFFHNVNNIPKISEVQNFLVLDY
IEEEPENEGEEEEQIGRADEQKEDEEEESLDELSTPMVYPIKSSIPHNHNEKVQLVTPDR
SVSIRSDEWDLKSNTEDEEGNVLADLKISSTKETKRQTDYVHIDSEDQSPVVSAQMRKMR
RESTKTLEILRQEFKDKDVQNKEDQSEQIQNPFVNTSSLVVGKSCLVNPKEKPNIDQTVV
GITELKSNSSIKKRDINILDTIFGQPPSKKQKQFHKKEKKKQQKKLTNFKPIIDVPSQDK
RNLRSNAPTKPKSIKVSKLRTDKKVTGEKSSPETAAEKVDDQTVRSNDEQAMSRATKEKC
FPDVNEGKEITKDDAKVSLESKKNNETFVDSSVVEKHTPPDKDCNNCNITDILESTTVID
LQSPHGLSAPGQNTFTNKLQEQIYSSINHFSNELVRKISIINQELNKKILKELSEKYQKL
FSELQDNFQNDTNEMLKFMGEIKDMMNLPEDQLVHAIRTRKFDNNKR
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgaagaaaaagatttttggtgtttgcctgaaaaatgacttagcacagact
aggaatgaaacgaaaggaatccactatgggttaatgactttggaaacttctaaacaactg
caggaatttctccatttgctagtaataaagagagaagtaattcaaaattttgagttgtta
tttcacatcataaatgttgccgttaaaatcaccgattcaaatcttccaagtgatgatatc
tggcatttcattttaaaattaagattttcttctgagattaatatagacgaagactccaaa
gttttaaattatttacttgagactggcatcgcaatggaaaatccagtcagttggaaatgc
ttggccgttattagcagcatcctcagcagtgtccctcaatccaaaaagattataactaac
ctgatcgagacagaacatgccaaaaagattggtcagttgtttgataatattcaagatttg
caacaaggaaattttctggtggaaattctctctaactgttttaaaaaaagtgcttcaaat
tccaagaaagtggaaaaaatacctcagttatggcaaagcaggtctaagaacaagtttttc
tttgaaaatgaattttacccttttagcagcaaaaatgggagcttacaaacctgccaattc
ctgtgcaataatttcatgtcaactttatcctttacgggtattctaaggcaggtttcttat
agcggatctgaaacattaaaaaatctccgtatatttaagaaaaaagacgatgaaaattct
tacttcattcagtgcatttacaacaaaatctatctttggttagacgaaaaagcccctttg
gaatttgaaagaaagaaaatcaggattaccaaaaacttaaaaaataaaattcaaattaaa
ttgaggcaacctttccatgaatgtgtgagaactaccgctgataaaacagcactcttattt
aacaaaacgaaggggtttcagctggaatttgaagacgagaaattaggtgaaacttttttt
cacaatgtcaacaatatacctaagattagtgaagtacaaaactttttagttttagactat
attgaagaagaaccagagaatgaaggtgaagaagaagagcaaatcggaagggcagatgag
cagaaagaggatgaagaggaagaatctctcgatgaattatccactcccatggtatatcca
ataaaatcatctattccccataatcataacgaaaaggttcagttagtcactcccgaccgt
tctgtttccataagatctgatgaatgggatttaaagtcaaatactgaagacgaagaaggt
aatgttcttgcagacctgaaaataagcagcactaaggaaacaaaaaggcaaacagactac
gtccatattgattcagaagaccagtcaccagtagtatccgctcagatgagaaaaatgaga
agagaatctacgaaaacactagaaatattgagacaagagtttaaagataaggatgtacaa
aacaaagaagaccagtccgaacaaatacaaaacccgtttgtaaatacatcctcgttagtt
gtaggtaaatcctgtcttgttaatcctaaggaaaagcctaatattgatcaaacggtagtc
ggaataaccgaattaaagtcaaattcttccattaagaaaagggatatcaacattctcgac
actatatttgggcaacctccgtccaagaagcaaaaacaattccacaaaaaggagaaaaag
aagcagcagaaaaagttgacaaactttaagcccattatcgatgtcccttcccaagataaa
cgaaaccttaggtcaaacgctccgacaaaacccaaatccataaaagtaagtaagctgcgt
accgataagaaagttacaggggaaaaatcaagcccagaaacagcggcagagaaagttgat
gatcaaactgtgcgtagcaacgatgaacaagcaatgagcagagcaactaaagaaaagtgc
tttccagatgtcaatgaaggcaaagaaattactaaggatgacgctaaagtatctctcgag
tccaaaaaaaacaacgaaacttttgttgattcaagtgtagtagaaaaacataccccccca
gacaaagactgtaacaattgtaacattacagatattttggaatctaccactgttatcgac
ttgcagtcaccccatggattatctgctcctggtcagaatactttcacaaacaaacttcaa
gaacaaatttatagttcaataaatcatttttctaacgaattggtaagaaaaatttcgata
ataaaccaagagttaaataagaaaatcttaaaagagttgtccgaaaaataccaaaaacta
ttctccgaattacaagataatttccagaatgataccaatgagatgcttaaattcatgggc
gagatcaaagacatgatgaatctcccggaagatcagctcgttcatgctattaggacaaga
aaatttgataacaacaagagataa

DBGET integrated database retrieval system