KEGG   Saccharomyces cerevisiae (budding yeast): YLR272CHelp
Entry
YLR272C           CDS       T00005                                 

Gene name
YCS4, LOC7
Definition
Ycs4p
Orthology
K06677  
condensin complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(683672..687202)
Genome map
AA seq 1176 aa AA seqDB search
MSGFSLSEYLTKFQTTDRESYPRLQDPSRELNVIIDQLAVSPEQIDASPDSLEALIDLCH
DFPHLTPKLQTQLSYLISSSLSNLSKDIKANLSSNVNFTEIGGLIPQWKRHLEEYGYLIQ
VLLTFLQDELHKVSSQSTNLNRSAKNSKNDSANVELFKRDCNQMENLLESITKLLEINLS
KIFQTTPEKDLFIGLFTRPLFVLLEIEPVTKVSSLKMFIQRILAMCVKNHGQSSSIQSSL
MTNLTYFLHLSVFNAELLKLLNDEYNYPQLTEDILKEISTRVFNAKDTTGPKAISNFLIK
LSELSPGIMLRQMNLVITLLNNSSITLRCSVVEACGNIVAELAQDPQTMEHYKQQIAVLI
ELLEERFQDSNPYVRTKAIQGCSKICDLSSKFNKSKAKFTSLAVRSLQDRSSLVRRNSVK
LLSKLLLKHPFKAIHGSQLRLSEWEEYLKGSESQLNSTLKKVESQETLNDTIERSLIEEE
VEQDEGQCRTELEGSFNKSAELSRIENEVENINATNTSVLMKLKLMIVYYKDAISFIKEI
HKSIELISNLLFSKNRNEVLESMDFLVLADAFDIELSEFGIKKMLHLVWMKGTNDEGTSI
SVHLIECYKQLFLTAPDSCNMQEKAAHIAKNLINLSIGASIADLASLEQLLGMMYEQKLI
DQHVINILWAIYNSASKASMQKEQNVNNRDSEKGFSKEQIHGSIIILGMLSLADNEIALK
GLESLLNIGLGAVGLKDLTLCRYSCLALERMVPKRSTIITKAINQELEDVAVKKLYAIII
NYTKDNEYYPMCEQALSALFTISSKPDILATDLIREKTMMTFGKPEEEDSILSLEQSSRV
VSLSQLLFIVGQVAIKTLVYLEKCEAEFKKRKIEAETRNGKVKNQGADVTNTTQDNGGDK
ELEMIGGTNEDDFTDAIQFVKENELLFGEKSILGKFCPIVEEIVSNSSRFSDPMLQRTAT
LCLEKLMCLSSKYCEKSLPLLITVMEKSPDPTIRSNAVLGLGDMAVCFNNLVDENTDYLY
RRLHDENLMVQRTCLMTVTFLILAGQVKVKGQLGEMAKCLDNPDQGISDMCRLFFTELAS
KDNAIYNGFIDIFSNLSSDDLLGKESFKKIIKFLLTFIDKERHQKQLNEKLVGRLRKCET
QKQWDDIAFVLNNLPYKNEDVTALLEQGFKVVSAKE
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctttagcctttccgagtatctgaccaagttccaaacaacagatcgagaatca
tatcctcgcttgcaggacccatccagagaactgaatgttatcatagaccaattggccgtt
tcacccgaacaaatagatgctagtccagattcactagaagcattaatagatctttgccat
gacttcccgcacttaacaccgaaattacaaactcaactaagctatttgataagttcatct
ctgtcgaatctgtcaaaagatattaaggctaatctctcatcaaatgttaactttactgaa
attggtggcctgataccgcagtggaaaaggcatttagaagagtatggctaccttattcag
gtacttttgacgtttttacaagatgagttacataaggtctcctcgcagtctaccaatcta
aaccgttctgccaaaaacagtaagaatgatagtgcaaacgtcgagctgtttaaaagagac
tgtaatcaaatggaaaacttgcttgaatctataacaaagctactggagattaacttatct
aagatatttcagacaactcctgaaaaggatttgtttattggtttgttcacaagaccatta
tttgtgttattagagattgaacctgtgacgaaggtatcatcactaaagatgtttattcaa
aggattttggctatgtgtgttaaaaatcacggtcaaagttcaagtatacaaagttcattg
atgacaaatttaacttattttcttcatttgtcggtttttaatgcagaattactaaaacta
ttgaatgatgaatataactatccacaactaacagaagatatcttgaaagaaatcagcacc
agggtatttaacgcaaaggataccacaggcccaaaggcaatatcaaattttttgattaaa
ttatcagagctatcaccaggaataatgcttcgacagatgaatcttgtcatcaccttactc
aacaatagttctataacattgagatgttccgttgtagaagcatgtggaaatattgtggct
gaattggctcaagacccacaaactatggaacattataaacaacaaatagccgtacttatt
gagttactagaagaaagattccaggattcaaatccctacgttagaacgaaggcgatacaa
gggtgttcaaagatctgcgatttgagttcgaaatttaacaaaagcaaagctaaatttact
tcgttggcagtacgatcattgcaggaccgctcctctttagttcgtaggaactcagtaaag
ttactttcaaaattattgctaaaacatccttttaaggccatacatggtagccaattgagg
ctgagtgaatgggaagaatatctcaaaggatctgaatcacagctaaattccactttaaag
aaagtagagtcacaagaaactctgaatgacacgattgaaaggtctttgattgaagaagag
gtagaacaagatgaaggtcaatgtaggaccgagttagaaggttctttcaataagagcgca
gaactttctagaatagaaaatgaggtagagaatataaatgcaacaaataccagtgttctc
atgaagctaaagttaatgattgtttactataaagatgccattagtttcattaaagagata
cacaagagtattgaattgatatctaatttgctgttttctaagaacagaaacgaagtttta
gaatcaatggacttcctagttttagcagacgcttttgacattgagttaagcgaatttggt
ataaaaaaaatgctgcatttggtttggatgaagggcacaaacgatgaaggaacgagtata
tcagtacatttgatagaatgttataagcagctatttttaaccgcgccagatagttgcaat
atgcaggagaaggcggcacatattgccaaaaatttaattaatctaagcatcggcgcatct
attgcagacttggcctctttggaacagctattaggaatgatgtatgaacaaaaattgatt
gatcaacatgtcattaatatcctttgggctatttacaattctgcatcgaaggccagtatg
cagaaagaacaaaatgtgaacaaccgtgactccgaaaaagggttttctaaggaacaaatt
catggttctattattattttaggaatgttatcgttagccgataacgaaatagcattaaaa
ggactggagtcacttttaaacattggacttggtgccgttggtttaaaagatctgaccctt
tgtcggtattcttgtttagcgttagagagaatggttcccaagagaagcactattattacc
aaggcaataaatcaagagcttgaagatgttgcagtgaaaaagttgtatgccataattatc
aactataccaaggataatgaatattatcctatgtgcgaacaagcgcttagtgcactgttt
acaatctcttctaagcccgatatactagctacagatctgattagagaaaagacaatgatg
acatttggtaaacctgaagaggaagactctattttgtcgttagaacaatcatctagagtt
gtttctctcagtcaattattattcattgtaggacaagtggcaattaaaacacttgtctat
ctagagaaatgtgaggcagaattcaagaaaagaaagatcgaggcagaaactcggaacggt
aaagtaaaaaaccaaggtgcagatgtaactaacaccacacaagataacggtggtgataaa
gagctagaaatgataggaggtactaatgaggacgatttcacggatgctattcaatttgta
aaagagaatgaattactatttggagaaaaatctatattagggaagttttgcccaattgta
gaagagattgtttctaattcaagcaggtttagcgatccaatgcttcaaagaacggcaacc
ttatgtctagaaaaactaatgtgtttatcatcaaaatattgtgaaaagagcctgccgcta
ttaatcacagtaatggaaaaatctcctgatcctactattcgctcaaatgctgtcttagga
ctaggtgacatggcagtatgcttcaacaacttagtagacgaaaacacagattatttgtat
cgccgtttgcatgatgaaaacttaatggtacaaagaacatgtttaatgacagttaccttc
ttgattttagctggacaggttaaggttaaaggacaattaggagaaatggccaaatgccta
gacaatccagaccagggaataagtgatatgtgcagattatttttcaccgagttagcatcc
aaggacaacgccatttataatggattcatcgatatctttagtaatttatcgtcagatgat
ttattgggtaaggagagtttcaagaaaatcatcaaatttctgttaacttttatcgataag
gaacggcaccaaaagcaattaaacgagaaattagttggaagactgagaaagtgcgagacc
caaaagcaatgggatgatattgcattcgtactaaacaatctaccatacaaaaatgaagac
gtcactgcattattggagcaaggtttcaaggttgtatccgcaaaagaataa

DBGET integrated database retrieval system