KEGG   Saccharomyces cerevisiae (budding yeast): YLR274WHelp
Entry
YLR274W           CDS       T00005                                 

Gene name
MCM5, BOB1, CDC46
Definition
Mcm5p (EC:3.6.4.12)
Orthology
K02209  
DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YLR274W (MCM5)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR274W (MCM5)
   04113 Meiosis - yeast
    YLR274W (MCM5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YLR274W (MCM5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:691555..693882
Genome map
AA seq 775 aa AA seqDB search
MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYS
LTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENT
SMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLS
IMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDP
YIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSI
YNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQL
SRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGT
AKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCID
EFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNI
DFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMK
RYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRIT
ESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKR
RLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgatagaccggaaatatacagtgctcctgttttacaaggagaatctcctaac
gacgatgataatactgaaatcataaagtcctttaagaatttcattttggagttcagactt
gactcgcaatttatttacagagatcagttaaggaacaacatccttgtgaagaattattct
ttaacggttaacatggagcatttgatcggatataacgaagacatatataagaaactatca
gacgaaccttcagatatcattccattattcgaaaccgcgatcacacaagtggctaaaagg
ataagtattctaagcagagctcaatctgctaataacaatgacaaagatccagaaaatact
agtatggatactgattctctcttattgaactctttaccaacatttcaattaattttaaac
tccaatgcaaatcagattccattgagagatttggattctgaacacgtctccaagattgtc
cgtttatcaggtattataatatccacgtcagttttatcttcccgtgccacgtacctttct
ataatgtgcagaaattgcagacacacaacatcaataacaatcaacaatttcaattctatc
acaggcaataccgtcagtttaccacgttcttgcttatctacgattgagagtgaatcttct
atggcaaacgagtcgaatattggtgatgaatcgaccaagaaaaattgtggacctgatcca
tatattattatccatgagtcttcaaagtttattgatcaacagtttttaaaattacaggaa
atcccagaactggttccagtaggtgagatgcctagaaacttaacaatgacttgtgaccga
tacctaacaaacaaagttattcctggtacgagagtcactatagtaggtatttattccatc
tataattctaaaaatggtgccggatccggaaggagcgggggtggaaatggaggaagtggt
gttgctattagaacaccttatatcaaaatattaggtattcagtccgatgtagaaacctcc
tctatttggaattcagtaactatgtttactgaggaggaagaagaggaatttctacagcta
agtagaaacccgaagctttatgaaattttgaccaactctattgccccctctatttttggt
aatgaagatataaaaaaagccattgtatgtttattgatgggtggttccaagaagatatta
cccgatggtatgaggttaagaggtgatatcaatgtactattattaggtgatccaggtacc
gccaaatctcaactattgaaatttgtggagaaagtgtcacctattgcggtatatacatct
ggtaagggatcttctgcagctgggttaactgccagtgtacaaagagatccgatgacaaga
gaattttatttggaaggtggtgctatggtgcttgccgatggtggtgttgtatgcatcgat
gaattcgataaaatgagagatgaagatagagtggccattcatgaagctatggagcagcaa
acaatctccatcgcaaaagctggtatcactacagtgctaaattctagaactagtgtttta
gcggctgctaatccgatatacggccggtatgatgatttgaagtctcctggtgacaacatt
gatttccaaactactattttatcccgttttgatatgatttttattgttaaggatgaccat
aatgaagaacgtgatatttcaatagctaaccacgttattaatattcatacaggaaatgct
aatgctatgcaaaaccaacaagaggaaaatggcagtgaaattagtattgaaaagatgaaa
cgttacattacgtattgtagattgaaatgtgcaccaagactttcaccgcaggccgctgaa
aaactgtcatcgaacttcgtcaccattaggaagcaattattaatcaacgaattagagtca
acggaaaggtcgtctattccaattaccattcgtcaattagaagctattattagaataaca
gaatcattagccaagttagaattaagtcctattgcacaggagagacatgttgacgaagct
attagattgtttcaagcttccacaatggacgcagcgtctcaggatccaattggcggctta
aatcaagcaagcggaacatctttgtcagaaatccgtcgttttgaacaagaactaaaaaga
agattacctataggctggtctacttcttatcaaactttgaggagagaatttgtagataca
catagattttctcaattagcactggataaggccttatatgccctagagaagcatgaaaca
attcaattgagacaccagggacagaatatttacagaagtggtgtatga

DBGET integrated database retrieval system