KEGG   Saccharomyces cerevisiae (budding yeast): YLR288CHelp
Entry
YLR288C           CDS       T00005                                 

Gene name
MEC3, PIP3, PSO9
Definition
Mec3p
Orthology
K02544  
G2-specific checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YLR288C (MEC3)
   04113 Meiosis - yeast
    YLR288C (MEC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:complement(713480..714904)
Genome map
AA seq 474 aa AA seqDB search
MKLKLIVNGCEAPDDYKLLRTTINTVASLRKTAILRFNSERLTIISTPKSSLNSSNNGTI
LRGDTGQLWCTIPHDVFRLYTVISARELNTITMECNCDSLLSVFKRYDRVMNQGSSSNMT
IKLQSMPEWNTNNGTLSGGTAGGVDTTSKPNPICALGITFEEIVHTSGPNDAIVMNGGVD
EHNGLPTTVGTGNLLASNKVIMHSFKVPVKLLFRAQDTRIQEPMINYIQLMMYKLPPISG
EFGSAFHGFIRRVERYSNVNHIHLMGVKKKEHGNEGDDVELKIIVNELDWHLEICWNGPL
DSVIQRQEGLTDNPSQNQHIDTDGRQEEGSLPIIEADKPMSSLYTNTRDREMEENIRYDE
DLLRIEDSSIADTRGNIYTADTSGDTEFNDISVMVEKAEQESSSTHEVIIRCKDWKVCSK
LYAAFEEVVLAISHDESCVFHCSLDRGSLEDSEDVEKPRERGQIIYYIARSKGL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaattgatagtaaatggttgtgaagcacctgatgattataaattgctaaga
actactatcaatacagttgcttcgctacgaaagacggctatcttaagatttaatagtgaa
agattgacaataatatccactccaaaatcatcactcaacagcagtaacaacggtacaata
ttacgaggggatactggtcagctttggtgtaccattcctcatgatgtattcagattatat
acagttatatcagctcgcgagctcaatacaataacaatggagtgtaattgtgattcttta
ttgagtgtgtttaaaaggtatgatcgagtaatgaaccaaggatcttcctctaatatgact
ataaaactacagtcaatgccagaatggaatacaaataacggaacactttcaggaggaaca
gcaggaggcgtagatacaacctcaaaaccgaaccccatttgtgctctaggtataacattc
gaagaaattgtacatactagcggcccaaatgacgctatagttatgaatgggggagtggat
gagcacaatggtttaccaaccacagtaggcacaggaaatctactcgcaagcaataaggtt
atcatgcattcgttcaaagtacctgtcaaactattattccgagcacaagatacgcgaata
caagagccaatgattaactatattcaactgatgatgtacaagctgccaccaatatcgggc
gagtttggctccgccttccacgggtttattagacgtgttgaacggtacagtaatgtcaac
cacattcatttaatgggagtcaaaaaaaaggagcatggaaatgaaggtgatgatgtagaa
cttaagataattgtgaatgaattagattggcatttggaaatatgctggaatggaccctta
gactctgtgatacaacgccaagaagggctcactgacaatccttcccaaaaccagcacatc
gacacagacggccggcaggaggaaggatctcttccgattatcgaagcggataaaccgatg
tcttcactatataccaatactagagatcgagagatggaagaaaatatccgctacgatgaa
gatttattaagaattgaggatagctcgatcgcagatacgcggggaaacatttacacagct
gatactagcggtgatactgaatttaatgacatatccgttatggtggaaaaggctgaacag
gaaagttcgtccacacatgaagtaatcatccgttgcaaagattggaaggtgtgttccaag
ttatacgctgcatttgaagaagttgttttggcgatttctcacgacgaatcctgcgtattc
cactgttcgttggatcgtggtagcttggaagatagcgaagatgtggaaaaaccaagggaa
agaggacaaatcatatattatatagcaagatcgaagggcttgtaa

DBGET integrated database retrieval system