KEGG   Saccharomyces cerevisiae (budding yeast): YLR308WHelp
Entry
YLR308W           CDS       T00005                                 

Gene name
CDA2
Definition
(RefSeq) chitin deacetylase CDA2
  KO
K01452  
chitin deacetylase [EC:3.5.1.41]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YLR308W (CDA2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.41  chitin deacetylase
     YLR308W (CDA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
XII:747937..748875
Genome map
AA seq 312 aa AA seqDB search
MRIQLNTIDLQCIIALSCLGQFVHAEANREDLKQIDFQFPVLERAATKTPFPDWLSAFTG
LKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKL
SQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLP
NVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFD
WSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHC
VGGIDYIKEFLS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaatacaactaaatacaattgatttgcaatgtattattgcactttcctgtctgggg
caatttgttcacgcggaagctaatagggaagatttaaagcagatagactttcaatttcct
gtattggaaagggcagctacaaaaacgccttttccggattggcttagtgcatttaccggg
ttaaaagaatggcctgggttagatccaccttatatacctttagatttcattgatttcagt
caaattccagattataaggaatatgatcaaaaccattgcgacagtgttccaagggactcg
tgctctttcgattgccatcactgcaccgaacacgatgatgtgtacacatgttccaaactt
tcccagacatttgacgatggtccttctgcttccactactaaattattggaccggttgaag
cataattccaccttcttcaatttaggtgtcaatatagttcaacatccagatatctatcaa
agaatgcaaaaggagggacacttaatcggctcacatacctggtctcacgtatatttgcca
aatgtatcgaatgaaaaaattatagctcaaattgaatggtccatctgggcgatgaatgct
actggcaaccatacccccaaatggttcagacctccatatggcggaatagataatagagta
agagcaataacaaggcaatttggcttacaagccgtcttatgggatcacgatacttttgat
tggagcctccttctcaatgattctgtcataactgaacaagaaattcttcaaaatgtaata
aactggaacaagtcaggaaccggattaatattagaacacgattcaacggaaaaaactgtc
gatcttgccattaaaataaataagttgataggtgatgatcaatcaacagtttctcattgt
gtcggcggaattgattacataaaagaattcttgtcctaa

DBGET integrated database retrieval system