KEGG   Saccharomyces cerevisiae (budding yeast): YLR411WHelp
Entry
YLR411W           CDS       T00005                                 

Gene name
CTR3
Definition
Ctr3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XII:947253..947978
Genome map
AA seq 241 aa AA seqDB search
MNMGGSSSTAAKKATCKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQW
LTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKTTLIS
LQKSFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFLDHMIRVTIFVLQWGL
SYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYEPLGSLGANGSAQGTVSYDKESDDRKCC
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgggaggcagtagcagcactgctgccaaaaaagcgacttgtaaaatatcgatg
ttatggaattggtataccattgacacctgcttcattgccagatcttggagaaatgacacc
aaaggaaaatttgctggttcttgcatcggctgttttgcgcttgtggtggtagctcaatgg
cttactcgtttttcaaggcaatttgacgtagagctattaaaaagacagaaaataaagcat
ttagctagttactcgccagaggagtacgttgtcaaatgtggagaagaggatgctaaatct
gatatagaagaactacaaggcttttacaacgaaccaagctggaaaacaactttaatttcc
ttacaaaaaagtttcatttatagtttttacgtttggggtccaaggagattgaacgagcca
gaagacgacctgttaaagaaggtcctatcatgctgtacattaataacgccagtggatttg
tacccaacttttttggatcacatgataagagttactattttcgtattacagtgggggtta
tcttatatcatcatgctgctgttcatgtactataacggctatatcattattagttgttta
ataggtgctatcgttggtcgtttcatattttgctatgaacctctaggctcattgggtgct
aatggatcagcccagggtacagtgagttatgataaagagagtgatgatcgcaaatgctgc
ttgtag

DBGET integrated database retrieval system