KEGG   Saccharomyces cerevisiae (budding yeast): YML027WHelp
Entry
YML027W           CDS       T00005                                 

Gene name
YOX1
Definition
Yox1p
Orthology
K12411  
homeobox protein YOX1/YHP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YML027W (YOX1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    YML027W (YOX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:221406..222563
Genome map
AA seq 385 aa AA seqDB search
MSQETKMLPSLSSLLSGTEISSSPVSPSFTNPRTSFHLDDRGTIKLPPLNTSINRPRSVE
SALRHTVTSLHENSSAYGDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRD
YSVSSKKNDILTPLSAAKSIIIPSASKEKRRAFAFITHSQETFPKKEPKIDNAPLARRKR
RRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATSK
STTIIQTVSPPSPPLDVHATPLASRVKADILRDGSSCSRSSSSSPLENTPPRPHHSLNRR
SSTPSIKRSQALTFHLNPQKKTLTPVKTSPNSRVNKLINSIDHSPSKAKRPVSNPSGSPK
RKRKFGFKIVDQQPLKDLDPNAFRG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaacaaaaatgctaccttctctatctagtcttctatcgggaaccgaaatc
tcgtccagccccgtatcaccaagcttcactaatccaagaacgagttttcacctcgatgat
cgcggaaccataaaattaccaccgctaaacaccagtatcaatcgtccaagatctgtggaa
agcgccttgagacacactgttacatccttgcatgaaaatagcagcgcttatggtgatgac
atgctcaagcacacgcaatcagactcagccctctcatctcagttgaatagttctcaagaa
acagttgatgaatcacacgaaaaccttctactgactcccctaaatagcaaaaagagagat
tattcggtttcttcaaagaaaaacgacatattaacaccactctctgcagcgaagtcgatt
attatcccctctgcctctaaggaaaaaagacgtgcatttgctttcatcacacactcgcag
gagaccttccctaagaaggagcctaagatcgacaacgctccactagcacgccgaaagaga
agaagaacctcgtcccaggaactatctattcttcaggctgaatttgaaaaatgtcctgct
ccatcgaaggagaaacgaattgagttagctgaatcttgccatatgactgaaaaagccgtt
caaatatggttccagaataaaagacaagcggttaaaaggcagagaatcgccacttcgaag
tcaaccactataatacaaacggtatctccaccatctccgcctctggacgttcatgctacg
ccactagcatccagagtcaaggcggacatacttcgtgatggaagctcatgttctcgttct
tcctcttcttcaccgctggaaaatacgccgccaaggcctcatcattccctaaataggcgc
tcatccacaccaagcataaagagaagccaggctttaacattccatctaaacccacaaaag
aagacgttgactcccgtgaaaacgtctcccaacagcagagtaaataaattgatcaatagc
atagatcattctccatccaaagccaagcgtccggtaagcaatccctccggctcccctaaa
aggaagagaaaattcggattcaagatcgtcgatcaacaaccgttgaaggatcttgatccg
aacgctttccgtggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system