KEGG   Saccharomyces cerevisiae (budding yeast): YML059CHelp
Entry
YML059C           CDS       T00005                                 

Gene name
NTE1
Definition
Nte1p (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sce00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(153219..158258)
Genome map
AA seq 1679 aa AA seqDB search
MRSMNCTTNNTNNTGQNTKNSLGSSFNSSNYTSYRFQTCLTDQIISEAQTWSLSSLFNFS
WVVSYFVMGASRMIFRYGWYLATLSLLRIPKWIFFKLHHVQFTLSFWLILFALAVIVFVT
YTIMKERILSQYKRLTPEFLPLENTGKSGSSANINAASTQSANAPPAIGSSTTGASSIID
SKKHSLKDGNENETFLSSYLDQFLSAIKIFGYLEKPVFHDLTKNMKTQKMDEGEILLLDS
TIGFAIVVEGTLQLYHEVDHSDKDHGDETDHSDTDGLDDQDRDEEDEEEDDDIDNYDTKS
CSSNLIDEEDESVGYIHLKNGLGNFQLLNTVKPGNPLTSLVSILNLFTHSMSSYGNSNFP
SELSSPIDTTVSVNNMFCSSEQNFSNTDSMTNSTNSFPTFPSSMPKLVARAATDCTIGII
PPQSFAKLTAKYPRSASHIIQMVLTKLYHVTFQTAHDYLGLTKEIMDIEVLLNKSIVYEL
PYYLKEAVIRKFKTVDKSSGSADLEPKPKNSNASSKLKKPPKAKPSDGIIQSLKIANANA
NTSSNSLSLKPEFTHHPSSRHVVLGSRDQFNPGDLLSNVPLSRTMDILSPNPIHNNNRNK
SNGINTSTSNQHKRSSRSSSNNASVHSKKFSSLSPELRNAQLSTSPLSLDNTSVHDHIHP
SPVHLKGRVSPRPNLLPTTSFSAAQEETEDSALRMALVEAMLTYLGVNKSNMSVSSSSIA
NMSSLNSPQLNEMYSRRPSNASFLMSPHCTPSDISVASSFASPQTQPTMLRILPKEYTIS
NKRHNKSKSQDKKKPRAYKEELTPNLDFEDVKKDFAQGIQLKFFKKGTTIVEQNARGKGL
FYIISGKVNVTTNSSSSVVSSMSKPEQVSAQSSHKGENPHHTQHLLYSVGSGGIVGYLSS
LIGYKSFVNIVAKSDVYVGFLSSATLERLFDKYFLIYLRISDSLTKLLSSRLLKLDHALE
WVHLRASETLFSQGDSANGIYVVLNGRLRQLQQQSLSNSNTSSEEVETQNIILGELAQGE
SFGEVEVLTAMNRYSTIVAVRDSELARIPRTLFELLALEHPSIMIRVSRLVAKKIVGDRT
VPALTGDPLSIKENDFTSLIPPTKASYSSSLSHKPQNITSGTITFRTITILPITSGLPVE
AFAMKLVQAFKQVGRTTIGLNQRTTLTHLGRHAFDRLSKLKQSGYFAELEEMYQTVVYIS
DTPVKSNWTRTCIAQGDCILLLADARSPSAEIGEYEKLLLNSKTTARTELILLHPERYVE
PGLTHKWLRYRPWVHSHHHIQFSLTGTTLMNEGKMHVLNNGALALMDKLIQTEFSRKTQQ
NISKLLPDSIKNTVENFSSRFMKSKRQYYTPVHRHKNDFLRLARILSGQAIGLVLGGGGA
RGISHLGVIQAIEEQGIPVDVIGGTSIGSFVGGLYAKDYDLVPIYGRVKKFAGRISSIWR
MLTDLTWPVTSYTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITDSVQEIHSFGYAWR
YIRASMSLAGLLPPLEENGSMLLDGGYVDNLPVTEMRARGCQTIFAVDVGSADDRTPMEY
GDSLNGFWIIFNRWNPFSSHPNIPNMAEIQVRLGYVASVNALEKAKNTPGVVYVRPPIEE
YATLDFSKFEEIYHVGVDYGRIFLQGLIDDDKMPYIPGSQETTLNSQVPEFLLHRRNSI
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaatgaattgcactacgaacaacaccaacaataccggccaaaacacgaaaaac
agtcttggctccagctttaattccagtaattatacttcttatagattccagacatgtctc
accgaccagattatttctgaggcgcagacgtggtcactttcatccctcttcaacttctcg
tgggttgtgtcctactttgttatgggtgcctctcgtatgatcttcaggtacggttggtat
ctggcaactttatcgcttttaaggattccgaagtggatcttcttcaagttacaccatgtt
cagttcactctttccttttggctgatcctgtttgccctagccgtcatagtctttgtgact
tacaccatcatgaaggagagaattctatcccagtacaagaggctgaccccggagttcttg
ccgctggaaaatacaggtaaatctggctccagcgccaatatcaatgcagcttccactcag
tcagccaacgcgccacccgccataggttcctctaccacgggtgcaagctcgattatagac
tcaaaaaagcattcattgaaagatggcaacgaaaacgaaacctttctttcatcttacctt
gaccaatttctcagcgccatcaaaatctttggctatctggaaaaaccagtcttccatgac
ctgaccaagaatatgaaaactcaaaaaatggatgagggtgagattttactgttggacagt
actattgggtttgccatcgtcgttgaaggcaccctgcagttatatcatgaagtagatcat
tcagataaggaccatggcgatgaaactgaccacagtgacacggatggtcttgacgaccag
gatagagatgaagaagacgaagaagaagatgatgacattgataactacgacaccaaatct
tgttcttctaacctcatcgatgaagaagatgaatccgttggttacattcatctgaaaaat
ggactgggaaattttcaactgctaaatacagtcaagccaggaaacccgctgacctccctc
gtgagcattttaaacttattcacgcattccatgtcctcgtatggcaacagtaactttccc
tctgagttatcgtcacctatagacacaacggtgtcggtcaacaatatgttctgctcatca
gagcagaacttctccaacacagattccatgacaaactccaccaacagctttccaacgttc
ccctcttcaatgcctaaacttgtcgcccgtgcggctacagactgcacaattggtattatc
ccacctcaatcgtttgccaaattaaccgcaaaatacccacggtctgcttcccatatcata
cagatggttctcaccaagctataccatgttacgttccaaactgctcacgactacttaggt
ttaacaaaggagatcatggatatcgaagttttactaaataaatccatcgtttatgaattg
ccttattatttgaaagaggccgttattcgtaagtttaaaactgtagataagtcgagcgga
tcggctgatttagaaccgaaacccaaaaatagtaatgcttcctctaaattgaagaaaccg
cccaaagcgaagccatctgatggtatcattcaatcgcttaagattgctaacgccaacgct
aacacaagttcgaattccctttcactgaaaccagaattcacccaccatccaagttcgaga
catgtcgtactgggttcaagagaccaatttaatcctggtgatttactgtcaaatgtccca
ctgtctagaactatggatattctgtcacccaacccaatccataataacaaccgcaataaa
tcaaacggtattaacacttctacctctaaccaacataagcgatcttctaggagtagcagt
aacaatgcttccgtacactctaagaagttttcttctttgtccccagaattgcgcaacgca
caacttagtacatcgcccttgtccttggataatacttctgttcatgaccatatccaccca
agtcccgttcatttgaagggacgggtctctccaagacctaatttactgcccacaacatcc
ttttctgctgcccaggaagaaaccgaggactctgctttaagaatggctttagttgaggca
atgttaacatacttgggtgtaaacaaaagcaatatgtccgtttcatcttcttcgatagca
aatatgtcttctttaaactctcctcaacttaatgaaatgtatagccgccgtccaagtaac
gcaagttttctgatgtcccctcactgtacaccatctgacatttccgtagcttcatcattt
gcctctcctcaaactcaaccgacaatgttaagaatcctacccaaagaatacactatcagc
aataaaaggcataataaaagtaaaagccaggacaaaaaaaaacctagagcttacaaagag
gagttgacacccaatttggatttcgaagatgtcaagaaagactttgcacaaggcattcag
ttgaagttctttaaaaagggcaccacaattgttgagcagaacgctcgtggtaaaggccta
ttctatatcatttccgggaaagttaatgtgacaacaaattcgtcctcgtcagtagtatca
tcaatgtctaaaccagagcaggtttcagcccaaagttcacacaagggtgaaaatcctcat
catactcaacatttgttatactctgtaggatctggtggtattgtgggctacttgtcctct
ctaattggttacaaatcatttgttaatatcgttgccaagagcgatgtctatgttggattt
ttatctagtgcaaccttagaaagattgtttgataaatatttcctaatctacttacggatt
tctgattcattaaccaaattgctatcttcaaggttattaaagctcgaccatgctttagaa
tgggttcacttgagggcttctgaaactctattttcacaaggtgactcggctaacggtatt
tatgttgtcctgaatggtagactaaggcagctacaacagcagtcattgtcaaactccaat
acaagttccgaagaagttgaaactcagaacattattctaggagaactggcccagggggag
agttttggtgaagttgaagtgcttaccgctatgaatagatattcaacgatagtggcagtg
agggattctgaattagcgagaattccgagaacattattcgaactattagctcttgaacat
ccatctatcatgattagagtttccagattagttgctaaaaaaattgtcggagatagaact
gttccagcattaacaggcgatccattatctataaaggaaaacgacttcacttctttaata
cctccaacgaaagcgtcttactctagctctttaagtcataaaccccaaaatattacttct
ggcacaattacttttagaaccatcactatcttaccaattaccagtggactacctgtagaa
gcatttgctatgaagttagtgcaagctttcaaacaggtaggaaggaccacgattggttta
aatcaaagaactaccctaacacatttaggtcgtcatgcatttgacagattgtccaaatta
aaacaaagtggttactttgctgaactagaagaaatgtaccagactgttgtttatatatca
gatacaccagttaaatctaattggacaagaacctgtattgcgcaaggtgattgtattctc
ttactagcagatgctagatctccatcagccgaaataggagaatatgaaaagttattacta
aattcaaagactaccgcaaggaccgagttaattcttctacaccctgaaaggtatgtggaa
ccaggactaacccataagtggttacgctataggccatgggttcattcgcatcatcacatt
caatttagtttgacaggaacaaccttgatgaacgaaggcaaaatgcacgttttgaataat
ggtgccttggcattaatggataagttgattcaaacagaattcagtagaaaaactcaacag
aatatatcaaaactacttccagattctatcaagaacaccgtagaaaacttttcttcaaga
ttcatgaaaagtaaaagacaatattacacaccagttcataggcataaaaatgattttcta
agattggctagaattctttctggacaagctattggacttgtcctcggaggaggaggtgcg
agaggtattagtcatttgggtgtcattcaagctattgaagaacaaggtattccggtcgac
gttattggaggaacatcgattggttcctttgttggcggtttgtacgcgaaggattatgat
ttggtgccaatttacggccgcgtgaagaagtttgctggtcgaatttcctctatatggaga
atgttaacagatttaacctggccggttacttcttatactactggtcacgaatttaataga
ggtatttggaaaactttcggggatacaagaattgaagacttctggatccagtattattgt
aattctactaatataaccgattcggttcaagaaatacattcctttggttatgcgtggagg
tacatcagagcttcgatgtctcttgctggtcttttacctcctttggaagagaacgggtct
atgttactggatggtggttatgttgataatttaccagtaactgagatgagagcgcgtggt
tgccaaactatatttgcagtagatgtaggttctgcagatgatagaacgcctatggaatat
ggtgactccctaaatgggttttggatcattttcaatagatggaatccattttcttctcat
ccaaacatacccaatatggcagagattcaagttagattgggttacgtcgcatcagtaaat
gctttagagaaagcgaaaaatacaccaggtgtcgtttatgtgagaccacctattgaagaa
tatgccacattagactttagcaagttcgaagaaatttatcatgtgggtgtagactatggt
cgtatctttttgcaagggcttattgacgacgacaagatgccatatatacctggttcacaa
gaaaccactttgaattctcaagttcctgagtttttattacatagaagaaatagtatttga

DBGET integrated database retrieval system