KEGG   Saccharomyces cerevisiae (budding yeast): YML064CHelp
Entry
YML064C           CDS       T00005                                 

Gene name
TEM1
Definition
Ras family GTPase TEM1
Orthology
K06682  
Gtp-binding protein of the ras superfamily involved in termination of M-phase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YML064C (TEM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(145139..145876)
Genome map
AA seq 245 aa AA seqDB search
MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKR
KVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYG
LNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKI
ALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPS
PGVNT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctacaccaagcacgggagcaaacaattctatacctgcggtacgaaatcaggttgaa
gttcaggttggattagtaggggatgcacaagtagggaaaacatcgctgatggtgaagtac
gtacagaacatatacgataaggaatacacacagacgctgggagtgaactttttgaaaaga
aaagtaagcatacgctccacggatattatattttctataatggatttaggcggacaaaga
gaattcatcaacatgctcccaattgcgacggtagggtcttcagtgatcatatttctgttt
gacctgacacgtccagagacgttgagttcaataaaggagtggtataggcaggcgtacggg
ctaaatgattcggcaattcctattttggtgggcacaaagtacgatttactaatagactta
gacccggaatatcaggaacaaatctcgagaacgagtatgaagtatgcacaggtcatgaat
gctcctcttatattctgctctactgccaaatctataaacattcaaaaaattttcaaaatt
gcactggcaaagatctttaatttgacattaaccatcccagaaatcaatgaaatcggcgat
cctcttttgatatataagcacctaggtggccagcaacatcgacatcataacaaaagtcag
gatagaaagagccataatatcaggaagccctcctcgtcgccctcatctaaggcaccatcg
ccgggcgttaatacatga

DBGET integrated database retrieval system