KEGG   Saccharomyces cerevisiae (budding yeast): YML065WHelp
Entry
YML065W           CDS       T00005                                 

Gene name
ORC1
Definition
origin recognition complex subunit 1
Orthology
K02603  
origin recognition complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YML065W (ORC1)
   04113 Meiosis - yeast
    YML065W (ORC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:142210..144954
Genome map
AA seq 914 aa AA seqDB search
MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHN
EAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYN
KLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPT
GEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEAR
HTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKF
TKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVE
TIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWA
ASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVAN
TMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILI
DAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMK
ALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNK
FVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEE
AKRAMNEDETLRNL
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacgttgaaggatttacagggttgggagataataacaactgatgagcaggga
aatataatcgatggaggtcagaagagattacgccgaagaggtgcaaaaactgaacattac
ttaaagagaagttctgatggaattaaactaggtcgtggtgatagtgtagtcatgcacaac
gaagccgctgggacttactccgtttatatgatccaggagttgagacttaatacattaaat
aatgttgtcgaactctgggctctcacctatttacgatggtttgaagtcaatcctttagct
cattataggcagtttaatcctgacgctaacattttgaatcgtcctttaaattattacaat
aaactgttttctgaaactgcaaataaaaatgaactgtatctcactgcagaattagccgaa
ttgcagctatttaactttatcagggttgccaacgtaatggatggaagcaaatgggaagta
ttgaaaggaaatgtcgatccagaaagagactttacagttcgttatatttgtgagccgact
ggggagaaatttgtggacattaatattgaggatgtcaaagcttacataaagaaagtggag
ccaagggaagcccaggaatatttgaaagatttaacacttccatcaaagaagaaagagatc
aaaagaggtcctcaaaagaaagataaggctactcaaacggcacaaatttcagacgcagaa
acaagagctacagatataacggataatgaggacggtaatgaagatgaatcatctgattat
gaaagtccgtcagatatcgacgttagcgaggatatggacagcggtgaaatatccgcagat
gagcttgaggaagaagaagacgaagaagaagacgaagacgaagaagagaaagaagctagg
catacaaattcaccaaggaaaagaggccgtaagataaaactaggtaaagatgatattgac
gcttctgtacaacctccccccaaaaaaagaggtcgtaaacctaaagatcctagtaaaccg
cgtcagatgctattgatatcttcatgccgtgcaaataatactcctgtgattaggaaattt
acaaaaaagaatgttgctagggcgaaaaagaaatataccccgttttcgaaaagatttaaa
tctatagctgcaataccagatttaacttcattacctgaattttacggaaattcttcggaa
ttgatggcatcaaggtttgaaaacaaattaaaaacaacccaaaagcatcagattgtagaa
acaattttttctaaagtcaaaaaacagttgaactcttcgtatgtcaaagaagaaatattg
aagtctgcaaatttccaagattatttaccggctagggagaatgaattcgcctcaatttat
ttaagtgcatatagtgccattgagtccgactccgctactactatatacgtggctggtacg
cctggtgtagggaaaactttaaccgtaagggaagtcgtaaaggaactactatcgtcttct
gcacaacgagaaataccagactttctttatgtggaaataaatggattgaaaatggtaaaa
cccacagactgttacgaaactttatggaacaaagtgtcaggagaaaggttaacatgggca
gcttcaatggagtcactagagttttactttaaaagagttccaaaaaataagaagaaaacc
attgtagtcttgttggacgaactcgatgccatggtaacgaaatctcaagatattatgtac
aattttttcaattggactacttacgaaaatgccaaacttattgtcattgcagtagccaat
acaatggacttaccagaacgtcagctaggcaataagattacttcaagaattgggtttacc
agaattatgttcactgggtatacgcacgaagagctaaaaaatatcattgatttaagactg
aaggggttgaacgactcatttttctatgttgatacaaaaactggcaatgctattttgatt
gatgcggctggaaacgacactacagttaagcaaacgttgcctgaagacgtgaggaaagtt
cgcttaagaatgagtgctgatgccattgaaatagcttcgagaaaagtagcaagtgttagt
ggtgatgcaagaagagcattgaaggtttgtaaaagagcagctgaaattgctgaaaaacac
tatatggctaagcatggttatggatatgatggaaagacggttattgaagatgaaaatgag
gagcaaatatacgatgatgaagacaaggatcttattgaaagtaacaaagccaaagacgat
aatgatgacgatgatgacaatgatggggtacaaacagttcacatcacgcacgttatgaaa
gccttaaacgaaactttaaattctcatgtaattacgtttatgacgcgactttcatttaca
gcaaaactgtttatttatgcattattaaacttgatgaaaaagaacggatctcaagagcaa
gaactgggcgatattgtcgatgaaatcaagttacttattgaagtaaatggcagtaataag
tttgtcatggagatagccaaaacattgttccaacagggaagtgataatatttctgaacaa
ttgagaattatatcatgggatttcgttctcaatcagttacttgacgcgggaatattgttt
aaacaaactatgaagaacgatagaatatgttgtgtcaagctaaatatatcagtagaagaa
gccaaaagagccatgaatgaggatgagacattgagaaatttatag

DBGET integrated database retrieval system