KEGG   Saccharomyces cerevisiae (budding yeast): YMR006CHelp
Entry
YMR006C           CDS       T00005                                 

Gene name
PLB2
Definition
Plb2p (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YMR006C (PLB2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YMR006C (PLB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(277561..279681)
Genome map
AA seq 706 aa AA seqDB search
MQLRNILQASSLISGLSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLK
KRDAYTKEALHSFLSRATSNFSDTSLLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMI
AAMDNRTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIW
NITKSIVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAG
SALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAF
TDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFAN
KYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIK
KERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTN
KPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAAT
MGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPELSGNST
YQSGAIASAISEATDGIPITALLGSSTSGNTTSNSTTSTSSNVTSNSNSSSNTTLNSNSS
SSSISSSTARSSSSTANKANAAAISYANTNTLMSLLGAITALFGLI
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacggaacatattacaggctagctcgctaatttctggactttcgctcgctgca
gattcgtcgtccactactggtgatggttatgctccatcaataattccttgtcccagtgat
gatacctctttagttagaaacgcgtctggcttatctaccgctgaaactgattggttaaag
aaaagagatgcgtacactaaagaagctttacattccttcttaagcagagctacttctaac
ttcagtgacacttctttgctatccactcttttcagtagtaactcttccaatgtacccaaa
attggtattgcatgctctggtggtggttatcgtgccatgttgggtggtgctggtatgatt
gctgctatggacaatcgtactgatggtgctaacgagcatggtcttggtggtttactacaa
agttccacgtatctatcgggtttgtccggtggtaactggttgactggtactttggcatgg
aacaattggacctctgtacaggaaattgtagaccatatgagtgagagcgattccatctgg
aatatcacgaaatccattgtgaaccctggtggctctaatttgacctacacaattgaaaga
tgggagtccattgtacaagaagtgcaggctaagtctgatgcaggcttcaatatatctttg
tcggatttgtgggcccgtgcactttcttacaacttctttccaagcttgccagatgctggc
tccgctttgacttggtcctctttgagagatgttgatgtgttcaaaaacggtgaaatgcct
ttaccaattactgttgcagatggtagatacccaggtaccaccgtgataaacttgaatgcc
actcttttcgagttcactccatttgaaatgggttcttgggatccttctttgaacgctttt
acggatgtgaaatatctaggtaccaacgttacaaatggtaaaccggtcaacaaggatcaa
tgcgtttctggttacgataatgctggatttgtaattgccacatccgccagtttattcaac
gaattttccctggaagcttccacttcgacctattataaaatgattaatagttttgccaac
aagtacgttaacaacctatcccaagatgacgatgatattgcaatttacgctgcaaatcca
ttcaaggatacagaatttgttgaccgcaattacacttccagtattgttgatgccgatgat
ttgtttttagttgatggtggtgaggacggccaaaatttgccgttggttccactaatcaag
aaggaacgtgacttggatgtggtgttcgcattggatatatccgacaatactgatgaatca
tggccaagtggtgtgtgcatgacgaacacttatgagcgccagtattctaagcaaggtaaa
ggaatggctttcccatatgttccagacgttaacaccttccttaacttgggcttaactaat
aagccaacgttttttggttgtgatgcaaaaaatttgacggacttggagtatattccacct
ttagttgtatatatcccaaacacaaaacattcattcaatggtaaccaaagtactttgaag
atgaactacaatgttacagaacgtcttggaatgatcagaaatggttttgaagctgctaca
atgggcaactttacggatgactctaactttttaggttgcataggttgtgccatcattaga
cgtaagcaagaaagcctaaatgccaccttgccccctgaatgtaccaaatgttttgcggat
tactgctggaacggcacactaagtacctcagctaatcctgaactatcgggaaatagtacg
tatcaaagcggtgctattgcctctgcaatctctgaggctactgacggtattccaataacg
gctctcttaggttcatcaacctccggaaatactacatcaaactcaacaacctcgacttca
tcaaatgtcacttctaactcaaactcttcgtcaaatacaactttaaactcaaattcttca
tcctcttcaatttcttcctctacagctcgttcttcttcctctacggcaaacaaagcgaat
gctgcggctatttcctatgcgaacactaatactctaatgagtttgttaggtgccataaca
gcattatttggactaatttag

DBGET integrated database retrieval system