KEGG   Saccharomyces cerevisiae (budding yeast): YMR009WHelp
Entry
YMR009W           CDS       T00005                                 

Gene name
ADI1
Definition
(RefSeq) acireductone dioxygenase (Ni2+-requiring)
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce01100  Metabolic pathways
Module
sce_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YMR009W (ADI1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     YMR009W (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     YMR009W (ADI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_8
Motif
Other DBs
NCBI-GeneID: 855021
NCBI-ProteinID: NP_013722
SGD: S000004611
UniProt: Q03677
Position
XIII:284102..284641
Genome map
AA seq 179 aa AA seqDB search
MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV
VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES
GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALINQY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggtatatattcatgacaacaaggttgactccgattatcgcgcaccccacaat
tctggaacagaactttccctggatgaattagccaagttaggagtgatttataaatactgt
gcaaatgaggaagaagtgaatgaaattgctaggcaaagagaatataaaaatagagatgtg
gtcaacatctgcgaaggttccttcaaaagtgaagcagagtttaatgaaaaactagcaaca
ttctaccaagagcatttacatgaagacgaagaaataagatactgtctcgagggtgctgga
tactttgacgtcagggatgcttccacaccagagaactggattaggtgtttggtagagtca
ggtgatttactgattcttccaccaggcatctatcatcgtttcaccttgacaactagcaac
cacatcaaggccttgagactgtttaaggacgagcccaaatggcaagctatcaacaggtca
aatcaggctgattcattgcctgtacgcaaggactacattgccctgatcaatcagtactaa

DBGET integrated database retrieval system