KEGG   Saccharomyces cerevisiae (budding yeast): YMR036CHelp
Entry
YMR036C           CDS       T00005                                 

Gene name
MIH1
Definition
Mih1p (EC:3.1.3.48)
Orthology
K02555  
M-phase inducer tyrosine phosphatase [EC:3.1.3.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YMR036C (MIH1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     YMR036C (MIH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(341856..343520)
Genome map
AA seq 554 aa AA seqDB search
MNNIFHGTEDECANEDVLSFQKISLKSPFGKKKNIFRNVQTFFKSKSKHSNVDDDLINKE
NLAFDKSPLLTNHRSKEIDGPSPNIKQLGHRDELDENENENDDIVLSMHFASQTLQSPTR
NSSRRSLTNNRDNDLLSRIKYPGSPQRSSSFSRSRSLSRKPSMNSSSNSSRRVQRQDGKI
PRSSRKSSQKFSNITQNTLNFTSASSSPLAPNSVGVKCFESCLAKTQIPYYYDDRNSNDF
FPRISPETLKNILQNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIHSRDELEYEFIHK
VLHSDTSNNNTLPTLLIIHCEFSSHRGPSLASHLRNCDRIINQDHYPKLFYPDILILDGG
YKAVFDNFPELCYPRQYVGMNSQENLLNCEQEMDKFRRESKRFATKNNSFRKLASPSNPN
FFYRDSHQSSTTMASSALSFRFEPPPKLSLNHRRVSSGSSLNSSESTGDENFFPILSKSS
MSSNSNLSTSHMLLMDGLDTPSYFSFEDERGNHQQVSGDEEQDGDFTFVGSDREDLPRPA
RRSLFPSLETEDKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatatttcatggaactgaagatgaatgtgccaatgaagacgttcttagtttc
caaaaaatttccttgaaaagtccctttggtaagaagaagaacatatttagaaatgttcag
accttctttaagtcaaaaagcaaacattcgaatgtcgacgatgatttaatcaataaagag
aatcttgcctttgataaatctccattgttaacaaatcacaggagtaaggaaattgatggt
ccttcaccgaatataaagcagcttggccatcgcgatgagttagatgaaaatgaaaatgaa
aatgatgatatagtcttaagcatgcattttgcttctcaaaccttacaaagtccaacaaga
aactcatcaagaagatctttgaccaataatagggataatgatcttttaagtagaatcaag
tatcctggcagtccccagaggtcgagctctttttcaaggtcaaggtccttgtcgagaaag
ccaagcatgaatagcagtagcaattcaagcaggagggtgcaacggcaagatgggaaaatt
ccgaggtcatcgagaaaaagttcacagaaattttctaacattactcagaatactttgaac
ttcacgtctgcgtcatccagtccactagctcctaattcggtaggggtgaaatgttttgaa
tcatgcctagccaaaacacagataccatattattatgacgatcgtaactcaaatgacttt
ttccctcgaatttctccagaaacgttgaaaaatattctgcagaataatatgtgcgagtca
ttttataattcatgtcgtattatagattgtcggtttgaatacgaatatactggcggccac
ataataaactccgttaacatacactcgagagatgagttagagtacgaatttatccataaa
gttttgcatagcgatactagcaacaacaacactctaccaactcttttaattatccattgc
gaatttagttcccaccggggaccttcattggcctctcatttgagaaattgtgatcgtata
ataaatcaggatcattatcccaaattattctatcccgacatattgatattggatggcgga
tacaaagctgtttttgacaattttcctgaactatgttatccacgtcagtacgtgggaatg
aactcacaagaaaatttgctgaattgtgaacaagaaatggataagtttaggagagaatct
aaaagatttgctactaaaaataattcttttagaaaactagcttccccttcaaatcctaac
ttcttttatagagatagccatcaatcttcaacaacaatggcatcttctgcactatcgttc
aggtttgagccgcctccgaagctgtcattaaaccacagaagagtctctagtggttcatca
ttaaattcaagtgagagtacaggcgacgaaaatttcttccccatcttaagtaagtcgtct
atgagtagtaacagtaacctaagcacttcacatatgctactaatggacggactggatacc
ccatcatattttagtttcgaagatgagagaggcaatcatcagcaagtaagtggagatgaa
gagcaagacggagattttactttcgttggttccgaccgagaagatttacccaggcccgca
agaagatcgttattcccttctctagagactgaagataaaaaatga

DBGET integrated database retrieval system