KEGG   Saccharomyces cerevisiae (budding yeast): YMR043WHelp
Entry
YMR043W           CDS       T00005                                 

Gene name
MCM1, FUN80
Definition
(RefSeq) transcription factor MCM1
  KO
K12412  pheromone receptor transcription factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YMR043W (MCM1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YMR043W (MCM1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Yeast regulators
    YMR043W (MCM1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     YMR043W (MCM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRF-TF SUIM_assoc CAC1F_C
Motif
Other DBs
NCBI-GeneID: 855060
NCBI-ProteinID: NP_013757
SGD: S000004646
UniProt: P11746
Structure
PDB: 

Jmol
Position
XIII:353871..354731
Genome map
AA seq 286 aa AA seqDB search
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacatcgaagaaggtacgcctactaataatgggcaacagaaggagagaagaaag
atagaaattaagttcatcgagaataaaacaaggcgccatgtgacattttccaaaaggaag
cacggtatcatgaaaaaggcgtttgagctttctgttctaacggggacccaggtcctgttg
ctagtcgtttcagaaacaggtttggtatatactttcagcacgccgaagtttgaacctata
gtcacgcagcaggaaggtagaaacctgatccaggcctgtcttaacgcccctgatgatgag
gaagaagacgaggaggaagacggtgatgatgatgatgatgatgacgatgatggtaatgat
atgcaacgccagcaaccacaacaacagcaaccgcaacaacagcaacaagtattgaatgca
cacgcaaatagcttaggccatctaaatcaagatcaggtaccggcaggcgcgctgaaacaa
gaggtgaagtcacaattgctaggcggtgccaatcctaatcaaaactcaatgattcaacag
cagcaacatcacacgcagaattcacaaccacaacagcaacagcaacaacaaccacagcag
caaatgtcacagcaacaaatgtcacagcatcctcgaccacagcaaggaataccacatccg
caacaatcgcagccacagcaacagcaacaacaacaacaacaactgcaacagcagcaacag
cagcaacaacaacaacccctcaccggcattcatcagcctcaccaacaggcttttgccaac
gctgcctccccctatctgaatgctgaacagaatgctgcctaccaacaatactttcaagaa
ccgcaacaaggccaatactaa

DBGET integrated database retrieval system