KEGG   Saccharomyces cerevisiae (budding yeast): YMR043WHelp
Entry
YMR043W           CDS       T00005                                 

Gene name
MCM1, FUN80
Definition
Mcm1p
Orthology
K12412  
pheromone receptor transcription factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YMR043W (MCM1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YMR043W (MCM1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Yeast regulators
    YMR043W (MCM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:353871..354731
Genome map
AA seq 286 aa AA seqDB search
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacatcgaagaaggtacgcctactaataatgggcaacagaaggagagaagaaag
atagaaattaagttcatcgagaataaaacaaggcgccatgtgacattttccaaaaggaag
cacggtatcatgaaaaaggcgtttgagctttctgttctaacggggacccaggtcctgttg
ctagtcgtttcagaaacaggtttggtatatactttcagcacgccgaagtttgaacctata
gtcacgcagcaggaaggtagaaacctgatccaggcctgtcttaacgcccctgatgatgag
gaagaagacgaggaggaagacggtgatgatgatgatgatgatgacgatgatggtaatgat
atgcaacgccagcaaccacaacaacagcaaccgcaacaacagcaacaagtattgaatgca
cacgcaaatagcttaggccatctaaatcaagatcaggtaccggcaggcgcgctgaaacaa
gaggtgaagtcacaattgctaggcggtgccaatcctaatcaaaactcaatgattcaacag
cagcaacatcacacgcagaattcacaaccacaacagcaacagcaacaacaaccacagcag
caaatgtcacagcaacaaatgtcacagcatcctcgaccacagcaaggaataccacatccg
caacaatcgcagccacagcaacagcaacaacaacaacaacaactgcaacagcagcaacag
cagcaacaacaacaacccctcaccggcattcatcagcctcaccaacaggcttttgccaac
gctgcctccccctatctgaatgctgaacagaatgctgcctaccaacaatactttcaagaa
ccgcaacaaggccaatactaa

DBGET integrated database retrieval system