KEGG   Saccharomyces cerevisiae (budding yeast): YMR055CHelp
Entry
YMR055C           CDS       T00005                                 

Gene name
BUB2, PAC7
Definition
Bub2p
Orthology
K02179  
cell cycle arrest protein BUB2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(386101..387021)
Genome map
AA seq 306 aa AA seqDB search
MTSIEDLISNPPLLLHSSLSQLRYLILSEGLPISEDKQQQRTRCYVWTVLSQTSMEASTQ
RYLALLKLGPPSTTIYQKIKNDTSRTFQTDPNFRNRVSEDALIRCLSCFAWQTQQRRQKT
RFGRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKL
LDISLRIIDPKLSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNI
LFVVAFLVKMRSKVFKSDSPVNLLRQFPDFDADEIIRLGVGFIAKIPAQIYDLLVDHLTD
PDIYIP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaattgaagatctgatatcaaatcctcccctgctactgcattcctcactctct
caacttcgctacctcatactcagtgaagggcttcccatatctgaagataaacagcagcag
cgcacgcgatgttacgtgtggacggtgctctctcaaacttctatggaggcgtctacacaa
cggtaccttgcgctcttgaaactgggcccaccttccacaaccatttaccaaaaaatcaag
aacgacacatccagaacttttcagacggatccaaactttagaaatagagtctcagaggat
gccctcatccggtgtctgtcgtgctttgcttggcaaacacaacaaagaagacaaaagact
cgttttggtcgcattcctgtgagcacatatgtgcagggcatgaacgtgttattagctcct
ctgctttactcatgtccttctgaacctatggcgtatcaacttttcactaagctttgttat
gaaatgataccgacgtatctaactaagaacctaaacggcgcccagaacggcgccaaacta
ctagatatttctctcagaatcattgatccaaagctgagtaaatttctatcggacaattta
cttacagcagagatttatggtatgccttccatactcacgttatccagctgcaataaaccg
cttgatcaggtcattaaactgtgggatttcatgtttgcatatggattccatatgaatatt
ctctttgtggtggcattcctagttaaaatgagatccaaggttttcaaatcggattcccct
gttaatttactacgacagtttccggattttgatgctgacgagatcattcggctgggcgtc
gggttcatcgctaagatccctgctcaaatttatgacctattggtagaccacttgaccgac
ccagacatatatataccgtaa

DBGET integrated database retrieval system