KEGG   Saccharomyces cerevisiae (budding yeast): YMR099CHelp
Entry
YMR099C           CDS       T00005                                 

Definition
glucose-6-phosphate 1-epimerase (EC:5.1.3.15)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:complement(463934..464827)
Genome map
AA seq 297 aa AA seqDB search
MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW
PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL
YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP
WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKYQAIQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaaagaaactgataaagaagttgttttgactcatccagctgatgagaccacc
agcgttcatattctaaagtacggtgctacagtttattcttggaaattgaaatctgaagaa
cagttgtggttgtctactgctgctaaattggatggtagcaaacctgtgagaggtggtata
cctttggtctttcctgtattcgggaaaaatagcaccgatgaacatttgagtaaattacct
caacatggtcttgcaagaaattctacttgggagtttttgggtcaaactaaggaaaaccca
ccgaccgtacaatttggcttgaaaccagaaattgctaacccagaattgaccaaattgtgg
ccaatggattatcttttgattttgactgttgaattaggctccgattatttgaaaactgcc
atagaagtagaaaacacatctagttccaaggaattaaagttcaactggttgttccataca
tacttccgtatcgaagatattgaaggaacaatggtctctaatttagctggcatgaaactt
tatgaccaactgttgaaggaatcctacgtcgacaagcacccagtcgttaccttcaatcaa
gaaaccgatgtaatttatcagaatgtcagcgccgaacgggccattcaaatagttgacaag
ggcgttcaaattcacactctaaaaagatacaacttgcccgacactgttgtttggaatcca
tggattgagaagtctcaagggatggccgatttcgaaccaaaaactggttaccaacaaatg
atatgtattgaacctggtcatgttcatgattttatttccttggctcctggtaaaaaatgg
aatgcttatcaattactttgcaaagaagaattgaaatatcaagctattcaataa

DBGET integrated database retrieval system