KEGG   Saccharomyces cerevisiae (budding yeast): YMR099CHelp
Entry
YMR099C           CDS       T00005                                 

Definition
glucose-6-phosphate 1-epimerase (EC:5.1.3.15)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YMR099C
Enzymes [BR:sce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YMR099C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:complement(463934..464827)
Genome map
AA seq 297 aa AA seqDB search
MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW
PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL
YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP
WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKYQAIQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaaagaaactgataaagaagttgttttgactcatccagctgatgagaccacc
agcgttcatattctaaagtacggtgctacagtttattcttggaaattgaaatctgaagaa
cagttgtggttgtctactgctgctaaattggatggtagcaaacctgtgagaggtggtata
cctttggtctttcctgtattcgggaaaaatagcaccgatgaacatttgagtaaattacct
caacatggtcttgcaagaaattctacttgggagtttttgggtcaaactaaggaaaaccca
ccgaccgtacaatttggcttgaaaccagaaattgctaacccagaattgaccaaattgtgg
ccaatggattatcttttgattttgactgttgaattaggctccgattatttgaaaactgcc
atagaagtagaaaacacatctagttccaaggaattaaagttcaactggttgttccataca
tacttccgtatcgaagatattgaaggaacaatggtctctaatttagctggcatgaaactt
tatgaccaactgttgaaggaatcctacgtcgacaagcacccagtcgttaccttcaatcaa
gaaaccgatgtaatttatcagaatgtcagcgccgaacgggccattcaaatagttgacaag
ggcgttcaaattcacactctaaaaagatacaacttgcccgacactgttgtttggaatcca
tggattgagaagtctcaagggatggccgatttcgaaccaaaaactggttaccaacaaatg
atatgtattgaacctggtcatgttcatgattttatttccttggctcctggtaaaaaatgg
aatgcttatcaattactttgcaaagaagaattgaaatatcaagctattcaataa

DBGET integrated database retrieval system