KEGG   Saccharomyces cerevisiae (budding yeast): YMR105CHelp
Entry
YMR105C           CDS       T00005                                 

Gene name
PGM2, GAL5
Definition
phosphoglucomutase PGM2 (EC:5.4.2.2)
Orthology
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YMR105C (PGM2)
   00030 Pentose phosphate pathway
    YMR105C (PGM2)
   00052 Galactose metabolism
    YMR105C (PGM2)
   00500 Starch and sucrose metabolism
    YMR105C (PGM2)
   00520 Amino sugar and nucleotide sugar metabolism
    YMR105C (PGM2)
  Nucleotide metabolism
   00230 Purine metabolism
    YMR105C (PGM2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YMR105C (PGM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(475897..477606)
Genome map
AA seq 569 aa AA seqDB search
MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG
GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH
NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG
PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD
EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG
YGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG
WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT
IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG
DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE
EYLKPIINSVIKFLNFKQVLGTEEPTVRT
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcaaattgaaacggttcccaccaaaccatatgaagaccaaaagcctggtacc
tctggtttgcgtaagaagacaaaggtgtttaaagacgaacctaactacacagaaaatttc
attcaatcgatcatggaagctattccagagggttctaaaggtgccactcttgttgtcggt
ggtgatgggcgttactacaatgatgtcattcttcataagattgccgctatcggtgctgcc
aacggtattaaaaagttagttattggccagcatggtcttctgtctacgccagccgcttct
cacatcatgagaacctacgaggaaaaatgtactggtggtattatcttaaccgcctcacat
aatccaggtggtccagaaaatgacatgggtattaagtataacttatccaatgggggtcct
gctcctgaatccgtcacaaatgctatttgggagatttccaaaaagcttaccagctataag
attatcaaagacttcccagaactagacttgggtacgataggcaagaacaagaaatacggt
ccattactcgttgacattatcgatattacaaaagattatgtcaacttcttgaaggaaatc
ttcgatttcgacttaatcaagaaattcatcgataatcaacgttctactaagaattggaag
ttactgtttgacagtatgaacggtgtaactggaccatacggtaaggctattttcgttgat
gaatttggtttaccggcggatgaggttttacaaaactggcatccttctccggattttggt
ggtatgcatccagatccaaacttaacttatgccagttcgttagtgaaaagagtagatcgt
gaaaagattgagtttggtgctgcatccgatggtgatggtgatagaaatatgatttacggt
tacggcccatctttcgtttctccaggtgactccgtcgcaattattgccgaatatgcagct
gaaatcccatatttcgccaagcaaggtatatatggtctggcccgttcattccctacctca
ggagccatagaccgtgttgccaaggcccatggtctaaactgttatgaggtcccaactggc
tggaaatttttctgtgctttgttcgacgctaaaaaattatctatttgtggtgaagaatcg
tttggtactggttccaaccacgtaagggaaaaggacggtgtttgggccattatggcgtgg
ttgaacatcttggccatttacaacaagcatcatccggagaacgaagcttctattaagacg
atacagaatgaattctgggcaaagtacggccgtactttcttcactcgttatgattttgaa
aaagttgaaacagaaaaagctaacaagattgtcgatcaattgagagcatatgttaccaaa
tcgggtgttgttaattccgccttcccagccgatgagtctcttaaggtcaccgattgtggt
gatttttcatacacagatttggacggttctgtttctgaccatcaaggtttatatgtcaag
ctttccaatggtgcaagattcgttctaagattgtcaggtacaggttcttcaggtgctacc
attagattgtacattgaaaaatactgcgatgataaatcacaataccaaaagacagctgaa
gaatacttgaagccaattattaactcggtcatcaagttcttgaactttaaacaagtttta
ggaactgaagaaccaacggttcgtacttaa

DBGET integrated database retrieval system