KEGG   Saccharomyces cerevisiae (budding yeast): YMR127CHelp
Entry
YMR127C           CDS       T00005                                 

Gene name
SAS2
Definition
Sas2p (EC:2.3.1.48)
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YMR127C (SAS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(522329..523345)
Genome map
AA seq 338 aa AA seqDB search
MARSLSQSLTATTQKLKGKKNGGKGKNKPSAKIKKTQKEMLYGILNERNIRQIQFGLNKK
FSTWYGSAVYFDPETKRLGCSETKGQLSSVSNSQYWLDTLFVCEYCFKYTDDQTRFVGHV
ASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTKLYLDNKSMYFKVDHYEFY
IVYETGSTKPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLIEFSYKLSQLEGVISG
PEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDLSIVTGMRVNDVILTLKHLN
CIGENNQIYLQSLNSWLKLHGTKRNWFKLKDEYLLIDD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatctttaagtcaatcactcacagcgactacccagaagctaaaaggaaagaag
aatggtggaaaaggcaagaataagccctcagcaaaaattaaaaaaactcaaaaagagatg
ctatatggaatactgaacgaaaggaacataagacagattcagtttggactgaataaaaaa
ttctctacttggtatgggagcgccgtttatttcgatcctgaaacaaaaaggctagggtgc
tccgagaccaagggtcagctttcctctgtttctaacagccaatactggctagacactctt
ttcgtttgtgaatactgcttcaaatacacggatgatcagacgcggtttgtaggacatgtt
gcaagttgtccatttcaatatcgtgttccaggcaaaataaaatacaagagtcctgaatat
acaataagaagagtaaaaggatccaagtatcaactcttttgccaatgtctttgtcttttc
actaagctatatctggacaataaatccatgtatttcaaagtagatcattatgaattttac
atagtttatgaaactggatcaacaaagccgatgggattcttttcgaaagatttagtgtca
tatcagcaaaataatctagcgtgcatcttgatatttcccccatatcaacgacgtggatta
ggccttttacttatcgagttttcatacaaactatcccaattagaaggtgtaatatcaggg
ccagaagtaccgttatcaccttttggactaatcgggtacttgaaatattggtcacagata
ctctgttggcaccttattgaaggtgacctcgcccattatgataaagtgaccctggaggat
ctttccatcgtgactggaatgagagtcaatgatgttattttgaccttgaagcacttgaac
tgtattggggagaataaccaaatttacttgcagtcattgaatagctggttgaaactacat
ggaacaaaacggaattggttcaaattaaaagatgaatatttgctgatagatgactag

  All links  
No link information was found.   
DBGET integrated database retrieval system