KEGG   Saccharomyces cerevisiae (budding yeast): YMR199WHelp
Entry
YMR199W           CDS       T00005                                 

Gene name
CLN1
Definition
Cln1p
Orthology
K12760  
G1/S-specific cyclin CLN1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YMR199W (CLN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:662644..664284
Genome map
AA seq 546 aa AA seqDB search
MNHSEVKTGLIVTAKQTYYPIELSNAELLTHYETIQEYHEEISQNVLVQSSKTKPDIKLI
DQQPEMNPHQTREAIVTFLYQLSVMTRVSNGIFFHAVRFYDRYCSKRVVLKDQAKLVVGT
CLWLAAKTWGGCNHIINNVSIPTGGRFYGPNPRARIPRLSELVHYCGGSDLFDESMFIQM
ERHILDTLNWDVYEPMINDYILNVDENCLIQYELYKNQLQNNNSNGKEWSCKRKSQSSDD
SDATVEEHISSSPQSTGLDGDTTTMDEDEELNSKIKLINLKRFLIDLSCWQYNLLKFELY
EICNGMFSIINKFTNQDQGPFLSMPIGNDINSNTQTQVFSIIINGIVNSPPSLVEVYKEQ
YGIVPFILQVKDYNLELQKKLQLASTIDLTRKIAVNSRYFDQNASSSSVSSPSTYSSGTN
YTPMRNFSAQSDNSVFSTTNIDHSSPITPHMYTFNQFKNESACDSAISVSSLPNQTQNGN
MPLSSNYQNMMLEERNKENRIPNSSSAEIPQRAKFMTTGIFQNTGELTNRASSISLSLRN
HNSSQL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagaagtgaaaactgggttaattgtcactgcaaagcagacatattaccca
attgaattgtccaatgcagaactactaactcattacgaaaccatacaggaatatcacgag
gaaatctctcaaaatgtgctggtccaatcttccaagacaaaaccagacataaaattgatc
gatcagcaaccggagatgaatcctcatcaaactagagaagccatagtaacatttttgtat
caactttcagtgatgactagagtaagtaatggtatcttcttccacgctgtcaggttctac
gatcgctattgctctaagagagtagtgttaaaggaccaagctaaactagttgtaggcacc
tgcctttggttagcggccaaaacttggggagggtgcaaccatattataaacaacgtctcc
atccccacaggtggtaggttttatggtcccaatcctagagctcgtattccacgcctttct
gaattggttcattattgcggcgggtccgatttattcgatgaatcaatgttcattcaaatg
gaaagacatatcttggatactctgaactgggacgtttatgagcccatgattaatgactac
attttaaacgttgacgaaaattgtttgatacaatatgaactttacaaaaaccagttacaa
aataacaatagcaacggcaaagaatggtcctgtaagagaaagtcacaatcttctgacgac
agtgatgccacagtggaagaacatatcagtagttcaccgcaaagtactggactagatggc
gatacaactaccatggatgaagatgaagaactaaattccaaaattaaattgataaatttg
aaaagattcttaattgatctgagctgttggcaatacaacttgcttaaattcgaattatac
gaaatatgcaatggtatgttttctataataaacaaattcactaatcaagatcaaggccct
tttctctctatgcccattggtaatgatataaactcaaacactcaaacgcaggtattcagc
attatcatcaatggcatagtcaattctcccccatctttagtcgaagtttataaggagcaa
tatggtatagtacctttcatattacaagtaaaagattataacttggaattacaaaagaaa
ctgcaactggcctctacaatagacctaaccagaaaaattgctgtcaattctcgttacttt
gaccaaaatgcctcttcatcatcagtttcttctccaagcacatattcttcgggaaccaat
tatactccaatgcgaaacttcagtgcacaatcagacaacagtgttttcagtactaccaac
attgaccattcatcgccgatcacccctcacatgtacacttttaatcagtttaaaaacgaa
agtgcttgtgacagtgccataagcgtaagcagtctacctaatcaaacccaaaatggtaac
atgccattatcaagcaattatcagaatatgatgctagaagaaaggaataaagagaataga
attcccaactcatcatccgctgaaataccacaacgtgccaaatttatgacgactggtata
ttccagaacacaggagaacttactaatagagcgtcttcgatatcgctatcgttaaggaac
cacaatagctctcaactgtga

DBGET integrated database retrieval system