KEGG   Saccharomyces cerevisiae (budding yeast): YMR223WHelp
Entry
YMR223W           CDS       T00005                                 

Gene name
UBP8
Definition
Ubp8p (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YMR223W (UBP8)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YMR223W (UBP8)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YMR223W (UBP8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:716715..718130
Genome map
AA seq 471 aa AA seqDB search
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMC
LQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDD
VCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD
KCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHE
FWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTI
DPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVL
QLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHK
GTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttgtccacatatacagcaagtatttcagaatgaaaagtctaaagatggggtt
ctaaaaacgtgcaatgctgccaggtatatattaaatcattccgtacccaaggaaaaattc
ttaaacaccatgaaatgtggtacatgccacgaaataaactctggtgcaactttcatgtgt
ctacaatgtggattttgtggatgttggaaccattcgcattttctctctcacagtaaacag
attggtcacatatttggtatcaactcaaataatggccttttattttgcttcaaatgtgag
gactatatagggaatatcgatctgattaacgatgctatcctagcgaagtattgggacgac
gtgtgcacaaagaccatggttcctagcatggaaagaagagatgggctttctggcctgatc
aacatgggatccacttgtttcatgagtagtattctccaatgtctaatccataacccttac
tttattaggcactcaatgagtcaaattcattctaataattgtaaagtgcgttctccagat
aaatgtttttcatgtgcactcgataaaattgttcatgaactttatggagcgctgaataca
aagcaagcttcttcgtcatctacatctactaatcggcaaaccggattcatatatctttta
acttgtgcctggaaaatcaatcaaaatctagcagggtattcacaacaagatgctcatgaa
ttttggcagtttataattaaccaaatccaccaaagctatgttcttgatttgccaaatgcc
aaggaagtcagcagagcaaataataagcagtgtgaatgcatagtgcatactgtgtttgag
ggctccttggaaagttctattgtgtgtccaggctgtcaaaataattcaaagacaaccatt
gatccattcttggatctttctctggatatcaaggataagaaaaaactttatgaatgtctt
gacagtttccataaaaaagaacagttgaaggatttcaactatcattgtggggagtgtaac
agcactcaagatgcaataaagcaactaggcatacacaaattaccatcggttttggttttg
caattgaaaagattcgaacacctacttaatggaagtaacagaaaactagacgattttatt
gaatttccaacttatttaaatatgaaaaattactgttcaacgaaggaaaaagataagcat
tctgaaaatggcaaggttccagacattatttacgaattaatcggtattgtttcccacaag
gggacggttaatgagggacattatattgcattttgtaaaatttctggagggcaatggttt
aaattcaatgattccatggtctcctctatatctcaagaagaggttttaaaggaacaggca
tatttattattctacaccattcgtcaagtaaattga

DBGET integrated database retrieval system