KEGG   Saccharomyces cerevisiae (budding yeast): YMR223WHelp
Entry
YMR223W           CDS       T00005                                 

Gene name
UBP8
Definition
Ubp8p (EC:3.4.19.12 3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIII:716715..718130
Genome map
AA seq 471 aa AA seqDB search
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMC
LQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDD
VCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD
KCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHE
FWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTI
DPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVL
QLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHK
GTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttgtccacatatacagcaagtatttcagaatgaaaagtctaaagatggggtt
ctaaaaacgtgcaatgctgccaggtatatattaaatcattccgtacccaaggaaaaattc
ttaaacaccatgaaatgtggtacatgccacgaaataaactctggtgcaactttcatgtgt
ctacaatgtggattttgtggatgttggaaccattcgcattttctctctcacagtaaacag
attggtcacatatttggtatcaactcaaataatggccttttattttgcttcaaatgtgag
gactatatagggaatatcgatctgattaacgatgctatcctagcgaagtattgggacgac
gtgtgcacaaagaccatggttcctagcatggaaagaagagatgggctttctggcctgatc
aacatgggatccacttgtttcatgagtagtattctccaatgtctaatccataacccttac
tttattaggcactcaatgagtcaaattcattctaataattgtaaagtgcgttctccagat
aaatgtttttcatgtgcactcgataaaattgttcatgaactttatggagcgctgaataca
aagcaagcttcttcgtcatctacatctactaatcggcaaaccggattcatatatctttta
acttgtgcctggaaaatcaatcaaaatctagcagggtattcacaacaagatgctcatgaa
ttttggcagtttataattaaccaaatccaccaaagctatgttcttgatttgccaaatgcc
aaggaagtcagcagagcaaataataagcagtgtgaatgcatagtgcatactgtgtttgag
ggctccttggaaagttctattgtgtgtccaggctgtcaaaataattcaaagacaaccatt
gatccattcttggatctttctctggatatcaaggataagaaaaaactttatgaatgtctt
gacagtttccataaaaaagaacagttgaaggatttcaactatcattgtggggagtgtaac
agcactcaagatgcaataaagcaactaggcatacacaaattaccatcggttttggttttg
caattgaaaagattcgaacacctacttaatggaagtaacagaaaactagacgattttatt
gaatttccaacttatttaaatatgaaaaattactgttcaacgaaggaaaaagataagcat
tctgaaaatggcaaggttccagacattatttacgaattaatcggtattgtttcccacaag
gggacggttaatgagggacattatattgcattttgtaaaatttctggagggcaatggttt
aaattcaatgattccatggtctcctctatatctcaagaagaggttttaaaggaacaggca
tatttattattctacaccattcgtcaagtaaattga

DBGET integrated database retrieval system